KEGG   Paraburkholderia sprentiae: BJG93_26220Help
Entry
BJG93_26220       CDS       T04610                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pspw  Paraburkholderia sprentiae
Brite
KEGG Orthology (KO) [BR:pspw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJG93_26220
Enzymes [BR:pspw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BJG93_26220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like NAD_binding_8 K_oxygenase DAO Glutaredoxin FAD_oxidored Thi4 FAD_binding_3 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APA88795
UniProt: A0A1I9YRG7
LinkDB All DBs
Position
2:2215321..2216913
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLKSYLEKVSKPIELVASVDDSAKSQELLALLNDIATLSERVTVVERRGDSE
RKPSFSIGEAGKGSGIRFAGIPLGHEFTSLVLALLQVGGHPVKLDDAVIEQIRSLDGDYQ
FETYFSLSCQNCPEVVQALNVMALINPRIRHVAIDGALFQNEVDARQIMAVPTMFLNGET
FGQGRSGVKEILAKLDTNAGARAAKELENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTLAIENFVSVTETEGPTFATALEQHVKAYDVDIMDVQRAEALIPGRIHE
VRLANGAVLKAKTIILATGARWREINVPGEREYRNHGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVREVTLLEFGATLRADEVLQRKLRSLPNVTVVTQAQTTEITGDGKKV
NGLIYKDLASGEVKNVELEGVFVQIGLVPNTEWLKGTLELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLSAFDHLIRNSEEVAVAVEAEAEAAV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgccaatctcaagactcaactgaagtcgtacctcgaaaaagttagcaagcct
atcgagctcgtcgcctcggtcgacgacagcgcgaagtcgcaggaactgctggcgctgctg
aacgacatcgcgacgctgtcggagcgtgtcacggtggtcgagcgtcgcggcgacagcgag
cgcaagccgtcgttttcgattggcgaagcgggcaagggatccggcatccgtttcgccggc
attccgctggggcatgaattcacgtcgctcgtcctggcactgctgcaggtcggcggccac
ccggtcaaactcgacgatgcggtgatcgaacagatccgcagcctcgacggcgactatcaa
ttcgaaacgtatttttcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatggcgttgatcaatccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
aacgaagtcgacgcgcgccagatcatggcggtaccgacgatgttcctgaacggcgagacc
ttcggtcagggccgcagcggcgtgaaggaaatcctcgcgaagctcgacaccaacgccggt
gcgcgcgccgcgaaggaactggagaacaagccggtgttcgacacgctgatcgtcggcggc
ggcccggcgggcgcagcagcggccatttactcggcgcgcaagggcattgcgaccggtgtc
gtggctgagcgtttcggcggtcaggtgctcgacacgctcgcgatcgaaaacttcgtctcc
gtgaccgaaaccgaaggaccgacgttcgcgacggcgctcgaacagcacgtgaaagcctat
gacgtcgacatcatggacgtgcagcgcgccgaagcgctgattccggggcgcatccacgaa
gtgcgtctggccaacggcgcggtgctcaaggcgaagacgatcatcctcgcgaccggtgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgagtatcgcaaccacggtgtcgcgtac
tgcccgcactgcgatggcccgctgttcaagggcaagcgcgtcgcggtgatcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgcgggtctcgtgcgcgaagtgacgttgctc
gaattcggtgcgacgctgcgtgcagacgaggtgctgcaacgcaaactgcgcagtctgccg
aacgtgacggtcgtcacgcaggcgcagaccacggaaatcaccggcgatggcaagaaggtc
aacggtctgatctataaggacctcgcgtcgggcgaagtgaagaacgtcgagctcgaaggc
gtgttcgtgcagatcggtctggtgccgaacaccgaatggctgaagggcacgctcgagctg
tcgaagcacggcgagatcgtcgtcgatgcacgtggcgcgacgtcggtgccgggcgtgttc
gccgccggcgacgtcaccacggtgccgttcaagcagatcgtcattgccgtgggcgaaggc
gcaaaagcatcgctctccgcattcgatcacttgatccgcaacagcgaagaagtcgcggtg
gccgtcgaagcggaagccgaagcagcggtttga

DBGET integrated database retrieval system