KEGG   Punctularia strigosozonata: PUNSTDRAFT_105992Help
Entry
PUNSTDRAFT_105992 CDS       T03131                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
psq  Punctularia strigosozonata
Pathway
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_105992
Enzymes [BR:psq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PUNSTDRAFT_105992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18875990
NCBI-ProteinID: XP_007386319
JGI: 105992
LinkDB All DBs
Position
Unknown
AA seq 581 aa AA seqDB search
MRTFVVLSVILASVSSALAQTASAAAYVVTESPIAKAGLLANIGPSGSKSSGAKAGIVIA
SPSTTNPDYLYTWTRDSSLVFKAIIDQYTTGLDTSLRGLIDDFFTAESTLQQVSNPSGTV
STGGLGEPKFNIDETAFTGAWGRPQRDGPALRATALITYANYLYGSGNTTFVTNTLWPVI
KLDLDYIANNWNQTTFDLWEEVSSSSFFTTAVQHRSMREGAALATKLGVTALASTYTSAA
DSLLCFLQSYWNPTGGYITANTGGGRSGKDANTVLTSIHTFDPAAGCDAVTFQPCSDKAL
ANLKVYVDSFRSIYSINSGIASNAAVATGRYPEDSYYNGNPWYLTTLAVAEQLYDALIVW
NAQGSLTVTATSLPFFQQFSSSVTAGTYASSSTTFATLTTSIKTFADGFVAIVAKYTPSG
GGLSEQYDKATGAQLSAADLTWSYAAALTAFEARSGTTFASWGAAGLTTSCSAGTSTGSG
SGSGADTVTVNFQETATTTFGENIYLVGSISELGNWDPNSAIALSAANYPNWQVSVALPP
STAIQYKYIRIFNGAVTWESDPNRSLTTPASGSANENDTWR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccttcgtcgtcttgtccgtcatcctcgcctcggtctcaagcgctttggcgcag
accgcctcggccgctgcctatgttgtcacagagtcgccgatcgccaaggccggtctgctc
gccaacatcggccccagcggatccaagtcttcaggtgcaaaagctggcatcgtcatcgct
tccccttctactaccaatcccgactacctgtacacctggactcgtgactcctcgttggtc
ttcaaggcgatcattgaccagtacactacgggcctcgacaccagtctccgcggcttgatc
gacgacttcttcaccgccgagtcgaccctgcagcaggtctccaacccctctggaaccgtc
tctactggcggtctgggcgagcccaagttcaatatcgacgagactgcctttaccggcgct
tggggtcgtccccagcgagatggcccggctcttcgtgccaccgctctgatcacgtacgcc
aactacctgtacggatccggcaacactaccttcgtcaccaacacgctctggcccgtcatc
aagcttgacctcgactacatcgcgaacaactggaaccagactactttcgatctctgggag
gaggttagctcttcgtcgttcttcaccactgccgtgcagcaccgttcgatgcgcgagggt
gcggctctcgccaccaagctcggtgtgactgctttggcttcgacctacacttcggccgcc
gacagcttgctgtgcttcctgcagtcgtactggaaccccactggcggctacatcactgct
aacaccggcggaggacgcagcggcaaggatgccaacacggtcctcacgtccatccacacc
ttcgaccccgctgccggctgcgacgccgtcaccttccagccgtgctcggataaggcgctt
gccaacctcaaggtctacgtcgactcgttccgcagcatctacagcatcaactccggcatc
gcctccaacgccgccgtcgccaccggtcgttaccctgaggactcgtactacaacggcaac
ccctggtacctgaccaccctcgccgtcgccgagcagctctacgacgcgctcatcgtctgg
aacgctcagggctcgctcaccgtcaccgcgacctcgctccccttcttccagcaattttcg
tcatctgtcaccgccggcacctacgcgagctcctccacgaccttcgccacacttaccacc
tccatcaagaccttcgccgacggattcgtcgccatcgtcgccaaatacaccccgtccggc
ggaggactctcggagcaatacgacaaggccactggcgcgcagctgtccgccgcggatctg
acctggtcgtatgccgccgcgctcaccgcgttcgaggcgcgcagcggcacgacgttcgcg
tcgtggggcgctgctggccttactacttcctgctcggctggtactagcaccggctctggc
tccggcagcggcgcggacaccgtcaccgtcaacttccaggagaccgctactaccaccttc
ggcgagaacatctacctcgtcggttctatctcggagctcggaaactgggaccccaacagc
gccatcgccctgagtgcggccaactaccccaactggcaagtctccgtcgcgctccctccc
tcgaccgccattcagtacaagtacatccggatcttcaacggcgccgtgacctgggaaagc
gacccgaacaggagcctcactacgcccgccagtggatcggccaacgagaatgacacttgg
cgctga

DBGET integrated database retrieval system