KEGG   Punctularia strigosozonata: PUNSTDRAFT_115264Help
Entry
PUNSTDRAFT_115264 CDS       T03131                                 

Definition
(RefSeq) glutathione-S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psq  Punctularia strigosozonata
Pathway
psq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PUNSTDRAFT_115264
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psq02000]
    PUNSTDRAFT_115264
Enzymes [BR:psq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PUNSTDRAFT_115264
Transporters [BR:psq02000]
 Other Transporters
  Pores ion channels [TC:1]
   PUNSTDRAFT_115264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_5 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 18876718
NCBI-ProteinID: XP_007386253
JGI: 115264
LinkDB All DBs
Position
Unknown
AA seq 238 aa AA seqDB search
MGTPDEKIFPHATGLALKTFCPFVQRTWITLEEKNIPYQYKEVNPYKKEKHFLDINPKGL
VPAIEYKGQALYESLVLCEFLEEAYPQHEPHLLPEDPFKRALVRLELDHISKSILPAWFR
TIQAQDPQKQKENREELVGELRKLAQKVKGPYFLGEQFSLVDVAIAPWIVRDYILIENRG
FSRQSVGEGWEEYANFLETRETVLKTQSEHYAEIYARYLRDEAQSEAAKATRAGRAIP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggggacacccgatgagaaaatctttccccatgcgacgggtttagctctgaagacgttc
tgcccgtttgtacagaggacttggatcaccctcgaggagaaaaatatcccgtaccaatat
aaggaggtcaacccgtacaagaaggagaaacatttccttgatatcaaccctaagggtctc
gtccctgcgatcgaatacaaaggccaagctctgtacgagtcactcgtgctttgcgaattt
ttagaggaagcatacccgcaacacgagccccatctcctcccagaagaccccttcaagcgc
gccctcgtccgtctcgagctcgaccacatctccaagtcgatcctccccgcctggttccgc
acaatccaggcccaagatccccagaagcagaaggagaaccgagaggaactcgtgggcgag
ctgcgcaaactggcgcagaaggtcaaaggcccgtacttcctcggcgagcagttcagcctt
gtggacgtcgccattgcgccctggatcgtacgggactatatccttatcgaaaaccggggg
ttcagcaggcagtccgtgggcgaaggctgggaggagtacgcaaacttcctggagacgagg
gaaaccgtcctcaagacccaaagtgagcattatgcggaaatctatgctcgatacctgcgt
gacgaggcccagagcgaagcggccaaggcgacaagggctggaagagccataccttga

DBGET integrated database retrieval system