KEGG   Punctularia strigosozonata: PUNSTDRAFT_120001Help
Entry
PUNSTDRAFT_120001 CDS       T03131                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
psq  Punctularia strigosozonata
Pathway
psq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PUNSTDRAFT_120001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psq03400]
    PUNSTDRAFT_120001
Enzymes [BR:psq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PUNSTDRAFT_120001
DNA repair and recombination proteins [BR:psq03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     PUNSTDRAFT_120001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT BRCT_3
Motif
Other DBs
NCBI-GeneID: 18877221
NCBI-ProteinID: XP_007382816
JGI: 120001
LinkDB All DBs
Position
Unknown
AA seq 985 aa AA seqDB search
MLPTPAPSSPPRSPRQVPASTQQDGTSYPAPPPSVGSAPFYVLIQLFEKLQNERKPERRK
RLLDGWFNHWRQEIGYDLYPVLRLILPQKDRERAVYGLKEKNLAKAYIKLIPLGMKDADA
IRLLNWKKPADKDRSSGDFPTVLYEVVNKRSSVIKGLLTVHELNDVLDELSQNIGKQDVQ
SRILQRVYNRSTPEEQRWIVRIILKDMTISVKETTVFSVFHPDAHDLFNTCSDLKKVVWE
LWDPKRRLNAADKTIQLFRSFAPMLCKRPTRRLEDSVKEMGGRTFFIEEKLDGERMQLHK
RGNEYFYCSRKGKDYTYLYGKHVGMGSLTPFIDKAFDSRVEDIILDGEMLVWDPVSGRNL
PFGTLKTAALDRTRKEQNPRPCFKVFDLLYLNGMPLLQKSTKFRRRNLRACLTPIPGRIE
LVSEFEGKTAKDVRTRMEEVMENRGEGLIIKHPDSEYVLNGRNKDWIKVKPEYMDNMGET
VDVLVVAGNYGTGHRGGGVSTLVCAVLDDRRRPEEDDEPKYASVVRIGSGLSFADYVWIR
SKPWKIWAERNPPSFYLTAPKGTEDKGDVYLEPEDSFIIKVKAAEIVTSDLYYLGFTMRF
PRAVNIRDDLSVADCMTATEFLAEMSESKKRKVEEETVKPEKKRKTASKVHVLSEYGMGG
SRLKDVAVESVLFRGMRFMVVSDPKSRTGDEDKRDLMKLIHANGGKVAQVVSKKFPTLVV
YGGSTIPYDIRLIMQKDEADIIKPQWIFDCLSQSEVIPMTKKYFFHATSRRQETDEYRLP
DDDTVMAETANVALRPAIPTQQEDPEPKEEEDPSLTDWFNVKGDATAHQSPPGSDTESET
EPESDNEDTKEEDTEDGWYKIENLMSSEDAGRITELAEVVRGPQVEEEAEAAKMGEDDEA
MEYDQNLIFKHLCFYLDTPMNARNHGMPIKTKHESDIQQRFVEIDRLIRENGGRVADLDD
PKLTHIVLDKRDDSRRRELTKRTSK
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgactcctgctcccagttctccgcctcgttcgccacggcaagtgccagccagc
acccagcaagacggtaccagctatcctgcgccaccccctagtgtcggaagtgcaccattc
tacgtcctgatccagctcttcgagaagctccaaaacgagcgtaaacccgaacgcaggaag
agactgctggacggatggttcaaccattggcgccaagagataggctacgacctatatcct
gtcctgcgcttgattcttcctcagaaagatcgtgagagggccgtgtatggcctgaaggag
aagaacttggcgaaagcatacatcaagctaataccccttgggatgaaagacgcagatgcc
atccggttactgaattggaagaaacctgccgataaagatagatcttcgggggatttcccc
actgtcttgtacgaggtcgtgaacaagcggtcatccgtcataaaaggcttgctgaccgta
cacgaactgaatgacgttctcgatgagttgtctcagaatataggaaaacaagatgtacaa
tctaggattttgcagcgagtatataaccgttcaacgccggaggagcaacgctggatcgtc
cgtattatattgaaagatatgaccatctccgtcaaggaaaccaccgtgttctcagttttc
caccccgacgcccacgatctattcaacacttgttccgacctcaagaaggttgtgtgggaa
ctgtgggatcctaaaagacgtctgaacgccgcagacaagacgatccagttgtttcgttcg
tttgcaccgatgctctgcaaacgtccgacccgtcgactcgaagattcggtcaaggagatg
ggtggccggacgttcttcatagaagagaagctcgatggagaacgcatgcagcttcataaa
cgcgggaacgaatatttctactgctcgaggaaggggaaggattacacatatctatatggc
aagcatgttgggatgggtagccttacccctttcatcgacaaggcgttcgattcgcgagta
gaagatatcattcttgatggtgaaatgcttgtatgggatcctgtctccgggagaaacttg
ccattcggcaccctcaaaaccgcggcgttagatcggacgagaaaagaacagaatcctcgc
ccatgtttcaaggttttcgatctcttgtacctcaacggcatgcctctactgcagaaatcc
accaaattccgacgacggaacctgcgggcctgtttgaccccgatacccggtcgcatagaa
cttgtcagcgagttcgagggcaagacggccaaggacgtacgcacgcgcatggaagaggta
atggagaaccgtggagaaggccttattatcaagcacccggacagcgagtacgtgctcaat
ggacgtaacaaggattggatcaaagtgaagcccgagtacatggacaatatgggggaaacc
gttgatgtactggtcgttgccgggaactacggaactggacatcgtgggggcggtgtgtcg
accctggtgtgtgcggtcctggacgatcgccgaagaccggaggaggatgacgagccaaaa
tatgcctccgtcgtgcgtattggttccggtctcagtttcgccgactacgtatggatccgg
agtaaaccctggaaaatatgggccgagagaaatcctcctagcttttaccttacagcccca
aagggtaccgaggataaaggcgatgtatatctcgaaccagaagattctttcataatcaaa
gtgaaggctgctgagattgttacttcggacttgtattatcttggtttcacgatgagattt
cctcgcgcagtgaacatacgtgacgatctttccgttgccgattgcatgacagctacggag
tttctggctgaaatgtcggagagtaagaagcgcaaggtagaagaggagactgtgaagccg
gaaaagaaaagaaagacggcgtcgaaggttcacgtcctctccgaatatggaatgggtggg
tcgaggctgaaggatgtggcggtcgaatcggttctattcagaggaatgagattcatggta
gtatccgacccaaaatcgaggactggggacgaggacaagcgcgacctgatgaaactaatc
cacgccaacggtggaaaggtggcccaagttgtctcgaagaagttccctacactggttgtg
tatggagggtcgacaattccatacgacataaggttgatcatgcagaaggatgaggctgat
atcattaagcctcagtggatcttcgactgcctctcacagagcgaagtgatccctatgacg
aagaaatacttcttccacgcaacgtctcggaggcaggaaaccgacgagtatcggctaccg
gatgacgatacggtcatggcagaaacagcgaatgtcgcgttacgccccgcaatcccaact
cagcaagaggatccggagcctaaggaagaggaagatccgtccctgacggattggttcaat
gtcaagggcgacgcgactgcacatcagtcaccgcccggttctgacacagagtcagaaacc
gaaccagaatccgacaacgaagacaccaaagaagaagatactgaggatggctggtataag
attgagaatctcatgtccagcgaggatgcaggaaggatcacagaactggcggaagttgtt
cgtggacctcaggtcgaggaagaagccgaagcggcgaagatgggcgaagacgacgaagcc
atggaatacgatcagaacctaatcttcaagcatctctgcttctacttggatacacctatg
aacgcgcgaaaccatggcatgcctatcaagaccaaacacgagtccgacatccagcaacgc
ttcgttgagatcgacagactgatcagggagaacggcggacgcgtcgcagacttggacgat
ccgaagctcacacacatagttctggacaagagggacgatagccggcggcgagagctgacg
aagcggacgtcaaagtaa

DBGET integrated database retrieval system