KEGG   Punctularia strigosozonata: PUNSTDRAFT_141470Help
Entry
PUNSTDRAFT_141470 CDS       T03131                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
psq  Punctularia strigosozonata
Brite
KEGG Orthology (KO) [BR:psq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psq03036]
    PUNSTDRAFT_141470
Enzymes [BR:psq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PUNSTDRAFT_141470
Chromosome and associated proteins [BR:psq03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PUNSTDRAFT_141470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl FXMRP1_C_core
Motif
Other DBs
NCBI-GeneID: 18880736
NCBI-ProteinID: XP_007380473
JGI: 141470
LinkDB All DBs
Position
Unknown
AA seq 597 aa AA seqDB search
MAASTTVFLQDACLKHRYVRNKDTSNIVERPERIRAVKTGLSAAIARLEELQPRANPSVA
EHNAAEDLTAALQRMNLASNDAFEARSGVRVVKSSAAIDILHNAAVKYVHGDIDGDVYLE
NLKRWAAESISKIAEGGSEIPEGLNQGDLYLCSESLEAMQGALGTVCEAVDTVIAESSAN
AAPRTARSAFVAVRPPGHHCGEDTPSGFCFVNNVAVAAAHAHLKHGINRVLIFDIDLHHG
NGTQSIVWQINEETYRKSQELEAQRRFAESAENDIKLPDAAGLQVFYGSIHDVLSYPCED
GVPALVQAASTSVHGPHGQYIENIHLQPYSTDEHFWDVLYPQRYSAIFQRAEQFVQETGG
GGKDVLIFISCGFDACEHEYPSMSRHGRRVPVDFYHRFARDAMSFAQKYSQGRLVSVLEG
GYSDRALSSGAMAHLLGLVDESRAKKVDKEWWNVHNLARLEKATKKRARGARPSAPGPGD
EWLQRTQAIFASMTEGDTAIPVSLPPPSMTLRDRKSRTAATDAASTASGNTSTSAKKGAG
ARGKGTRSPRPPMEDSKTELSDPAIANTNDSPSKDGVSAKKLPRVILHVRSPPGPDT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccaccacagtgtttctacaggatgcatgcctcaagcatcgatacgtacgg
aacaaagacactagtaatattgtcgagcggccggaacgtataagagccgtcaaaactggt
ctgtcagctgctatagcgcgacttgaggaactacaaccgcgcgcaaaccctagcgttgct
gaacacaacgctgccgaggacctcactgccgcccttcagcgcatgaacttggcttccaat
gatgcattcgaagcacgctccggggttcgagttgtcaaaagctccgctgcgattgacatc
ctccataatgccgctgtgaagtatgtgcatggtgatatcgatggcgacgtttacttggaa
aacttgaagagatgggcggcagaaagtatatccaagattgctgaaggcggcagcgaaata
ccagaaggattgaaccagggtgatctgtatttatgctcagagtccttggaagcaatgcaa
ggcgcgctagggactgtttgcgaagctgtcgataccgtcatcgcagagtcatcggctaat
gcagccccgcgcacggctcgcagtgcctttgttgctgttcgaccaccgggtcaccactgt
ggagaagatacaccatctggtttctgctttgtcaacaatgtggcagttgcagcagcccat
gcacatctcaagcatggcataaatcgggtcttgatatttgatatagatctgcaccacggg
aacggaacgcagtccatcgtgtggcaaatcaacgaagaaacttaccgcaaatctcaggag
cttgaagcgcagcgacgatttgcggaaagtgcagagaacgatatcaaactacctgacgcc
gctggactacaagtgttctacggaagtatacacgatgttctttcttatccctgcgaggac
ggcgttccggctcttgtccaagctgcttcaacatccgttcatggacctcatggccagtat
atcgagaacatccatttgcagccttactcgacggacgagcatttttgggatgtgctgtac
ccacagcgatattctgctatattccagagagcggaacaattcgttcaagaaacggggggt
ggcggtaaagatgtcctgatcttcatcagttgtggctttgatgcttgcgaacatgaatat
ccctcgatgtctcgacatggccgccgagttcccgtggacttttatcatcgttttgctcgc
gatgcgatgtcctttgctcagaaatattctcaagggcgattggtgagcgtgctggaagga
gggtacagcgaccgcgccctctccagcggggccatggcccatttgctcggattggtagac
gaaagtcgcgcgaagaaggttgacaaggaatggtggaacgtacataacctcgcgaggctg
gagaaagcgacgaagaagcgcgcgagaggtgccaggccatccgcgcccgggcctggagat
gaatggctgcaacgcacacaagccatcttcgcctccatgaccgagggtgatacagcaata
cctgtatctctccctcccccgtcaatgacgctgcgtgatcggaaatctcgaaccgccgcc
accgatgctgcgagtaccgcctcgggtaacacatccacctcggcgaagaaaggcgctggc
gccagaggaaaaggaacgcggtccccacggcctccaatggaggattcgaagaccgaactg
tctgacccggcgattgcaaataccaacgattcgccatcgaaagatggagtttctgctaag
aagctgccgagagtaattctgcacgtacgatcgccgcctggcccggatacataa

DBGET integrated database retrieval system