KEGG   Punctularia strigosozonata: PUNSTDRAFT_47500Help
Entry
PUNSTDRAFT_47500  CDS       T03131                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
psq  Punctularia strigosozonata
Pathway
psq00052  Galactose metabolism
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PUNSTDRAFT_47500
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_47500
Enzymes [BR:psq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     PUNSTDRAFT_47500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18882890
NCBI-ProteinID: XP_007388336
JGI: 47500
UniProt: R7S5A3
LinkDB All DBs
Position
Unknown
AA seq 1020 aa AA seqDB search
MAVFAACAAFLLLLATAAGRELSALQRGLYGPSRALGSRDVPHSLNVSTCPGYALTALRE
SEHGLTAQLDLAGPACNAFGTDFANLTISVTYETQTRLHVSIADANRSNFVVPDSVLPRP
HGTHPKPASDLVFHYHPRPFAFWITRRSAPAHAAPLFDTRPSSLPATPLPPFVAGDNSTA
LDGFPLVFEDQYLQLTSALPKGTNIYGLGEVVASAGVRRDVGVDADGNPTRGTVQTMWAR
DIADPVDENEYGIHPFYIEQRYPDPSSSSSSSSSSQSERESKSEAHGVFLASAAGSDVLL
ATPPGSPVSLIEYRLLGGTLDFYFLSGPDPLSVAEQYSEIVGTPTWQPYWAFGFHLCRWG
YASVNETKEQVAAMRAAGIPLEVMWNDIDVYRAFRDFTSDPVSFPGAEMRAFVRELHADH
QRYVPIVDAAVAHVVNNGTDVYDPYTSGAERDVFVKNPDGSAYVGQVWPGYTVFPDWFSE
EAAGWWAEALRNWTDGGVTFDGLWLDMNEASSFCDGSCGTGIDISNTSTPFLLPGVPGNP
VSTYPECYDVDRFGPSGNITVNGTLTCNATSSFSAALTERADLVERKKDEKKDEKKERKK
DEKKRRGLGAGGQPDVELNAPPYAIHNGNGRLSLHALATNATHAGGFVELDTHNLWGTME
AIASHKALLDILPGKRPFIISRSTFAGAGRWTGHWLGDNFSLWSYMRYAIQGVLQFQMFQ
VPMVGADTCGFNGNTDEELCNRWMQLSAFFPFYRNHNELGALSQEPYRWDSVANASRTAI
ATRYALLPYWYSLFANASTRGTPPVRPLAFAFPDQPALAGLSDQFLVGPNVLVTPVLEPN
ATSVTGVFPAGAVWRDWYTHELVNMNVNGDGNGTATATLDAPLGHINVHVRDGAAMLLHA
EPGYTTTETREGPYELLVVLTADGHAQGEAYVDDGISVQPTPSKTVKFVASHGKLTVKPE
GKYEIAPKLTRVTILGAPHASSVEVGGKKAAHVSVDAGLQKVVVSGLELDLNRAQTITWS
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcttcgcggcctgcgccgcgtttctcctcctcctcgccaccgccgccggccgc
gagctctccgcgctccaacgcggtctctacggcccctcgcgcgcgctcggatcccgcgac
gtgccgcactcgctcaacgtgtcgacctgcccgggatacgccctcaccgcgctcagggag
agcgagcacggactgacggcccagctcgacctcgccggccccgcgtgcaacgcgttcggc
accgactttgccaacctgaccatcagcgtcacctacgagacgcagacgagactgcacgtc
tccatcgcggacgccaaccgctccaactttgtcgtccccgactccgtcctcccccgcccg
cacggcacgcaccccaaacccgcctccgacctcgtcttccactaccacccgcgccccttc
gccttctggatcacccgccgctccgcgcccgcccacgccgccccgctcttcgacacccgc
ccttcctccctccccgctacgcccctcccgccgttcgtcgcgggcgacaacagcaccgcg
ctcgacggcttccccctcgtcttcgaggaccagtacctgcaacttacctcggcattacct
aaaggcacgaacatttacggcctcggcgaggtcgtcgcctccgccggcgtccggcgcgac
gtcggcgtcgacgccgacggcaaccccacccgcggcacggtccagaccatgtgggcgcgc
gacatcgcggacccggtggacgagaacgagtacgggatccacccgttctacatcgagcag
cgctatcccgatccctcctcctcctcctcctcctcctcctcgtcccaatctgagcgcgag
tcgaaatcggaagcgcacggcgtgttcctcgcctccgccgccggctcggacgtcctcctc
gccaccccgcccggctcgcccgtctccctgatcgaataccgcctcctcggcggcaccctc
gacttctacttcctctccggcccggaccccctctccgtcgccgagcagtactcggagatc
gtcggcacgccgacgtggcagccctactgggccttcggcttccacctctgccgctggggc
tacgcgagcgtgaacgagaccaaagagcaggtggcggcgatgcgcgcggcggggatcccg
ctcgaggtgatgtggaacgacatcgacgtctaccgcgccttccgcgacttcacgtccgac
cccgtctccttccctggagcggagatgcgcgccttcgtacgggagctgcacgcggaccac
cagcggtacgtcccgatcgtcgacgccgccgtggcgcacgtcgtgaacaacggcacggac
gtctacgacccgtacacctcgggcgcggagagggacgtgttcgtcaagaacccggacggg
agcgcgtacgtggggcaggtgtggccgggctatacggtgttcccggactggttcagcgag
gaagcggcgggctggtgggcggaggcgctccggaactggacggacggcggggtgacgttc
gacggattgtggctcgacatgaacgaggcgagctcgttctgcgacggaagctgcggcacg
ggcatcgacatttcgaacacgagcacgccgttcctcctccccggcgtgcccggaaacccg
gtctcgacctaccccgaatgctacgacgtcgaccggttcggaccgagcgggaacatcacc
gtcaacggcaccctcacctgcaacgccacctcgtccttctccgccgccctcaccgagcgc
gccgatctggtggagaggaagaaggatgagaagaaggatgagaagaaggagaggaagaag
gatgagaagaagcggaggggattgggcgcgggcgggcagcccgacgtcgagctcaacgcg
ccgccgtacgcgatccacaacgggaacggccggctgtcgctccacgcgctcgccacgaac
gcgacgcacgccggcggcttcgtcgagctcgacacgcacaacctctggggcacgatggag
gccatcgcgtcgcacaaggcgttgctcgacatccttcccggaaaacggccgttcatcatc
agccggtcgacgttcgccggagccggacgctggacgggccactggctcggcgataacttt
agtttgtggagttatatgcggtacgcgatccagggcgtgctccagttccagatgttccag
gtgcccatggtcggcgctgacacttgcggcttcaacggcaacaccgatgaagagttgtgc
aaccgctggatgcagctttctgccttcttccccttctacaggaaccacaacgagctcggc
gcgctctcgcaggagccctaccgctgggacagcgtcgccaacgcgtcgcgcacggccatc
gccacccgctacgccctcctcccctactggtattcgcttttcgccaacgcgtcgacgcgc
ggtacgccgcccgtgcgcccgctcgcgttcgccttcccggaccagcccgcgctcgccggc
ctctcggaccagttcctggtcggcccgaacgtgctcgtcacgcccgtcctcgagccgaac
gcgacgtccgtgacgggcgtcttccccgccggcgccgtctggcgcgactggtacacccac
gagcttgtgaacatgaacgtgaatggggacgggaacgggacggcgacggcgacgctggac
gcgccgctggggcatatcaacgtgcacgtgagggacggcgcggcgatgttgttgcacgcc
gagccggggtatacgacgaccgagacgcgcgagggcccgtacgagctgttggtcgtgctc
accgcggacgggcacgcgcagggagaggcgtacgttgacgacgggatcagcgtgcagccc
accccgagcaagaccgtcaagttcgtggcgtcgcacggcaagctgacggtcaagcccgag
ggcaagtacgagatcgcgccgaagctgacgcgggtcacgatcctcggcgcgccgcacgcg
tcgtcggtcgaggtcggcgggaagaaggcggcgcacgtgtcggtcgacgccgggctgcag
aaggtcgtcgtgagcgggttggagctcgacctcaaccgggcgcagacgatcacctggtcc
tga

DBGET integrated database retrieval system