KEGG   Punctularia strigosozonata: PUNSTDRAFT_55501Help
Entry
PUNSTDRAFT_55501  CDS       T03131                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
psq  Punctularia strigosozonata
Pathway
psq00500  Starch and sucrose metabolism
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PUNSTDRAFT_55501
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psq01003]
    PUNSTDRAFT_55501
Enzymes [BR:psq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PUNSTDRAFT_55501
Glycosyltransferases [BR:psq01003]
 Polysaccharide
  Storage polysaccharide
   PUNSTDRAFT_55501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_trans_1_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 18883989
NCBI-ProteinID: XP_007388263
JGI: 55501
UniProt: R7S2M9
LinkDB All DBs
Position
Unknown
AA seq 757 aa AA seqDB search
MSDQKRDVRNPLLFECAWEVANKVGGIYTVIKTKVPVTVQEFGDRYCLIGPLSYKTAPME
VEAEEPSDPDVAATLESMRAQGVKILYGRWLIEGAPHVLLFDTGSVYSRLDEWKGDLWNL
AGIPTPPNDHETNETIVFGYLVAWFLGEYVARQRHTAVIAHFHEWQAGLAIPLCRKRQID
VTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTT
VSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHSTAKAKINEFVRGHFYGHYD
FDIDNTLYFFTAGRYEYRNKGVDMFIEALARLNFRLQKAGSKTTVVAFIIMPAATASYTI
ESLKGQAVTKQLQSTVNEITTRIGQRLFEHAARSNGDHGTNPLPDDLLSEEDKVTLKRRI
FALKRNALPPIVTHNMVDDANDPILNQLRRVKLFNASYDRVKIVFHPDFLNSNNPILGLD
YEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQDLIDRPQDEGCYI
VDRRSRSVEESVTELTENMFSFCNKTRRQRINQRNRVERLSPLLDWKNLGIEYSKARQLA
VRRAYPDAFYGSAEGDDEFYFTGAQKIDPISVPASPRFRGFGGLATPGDLGTLTEEMQRL
ATSDYNGGGYQWPGGEEEEDSYPFPLVMKVRSRASSIMSGASTPGGGAFRSLNEHDLRKA
DAALSHVQVDAALAEAHGVNTSENGSNAHANGVNGTS
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcaaaagcgcgacgttcgcaatcccctcctcttcgagtgcgcctgggaggtc
gccaacaaggtcggcggcatctacaccgtcatcaaaacgaaggtccccgtcaccgtccag
gaattcggcgacagatactgcctcatcggcccgctcagctacaagaccgcccccatggag
gtcgaggccgaggagccctccgatccggatgtcgctgcgacgctcgaatccatgcgtgcg
cagggtgtcaaaattctctacggccgatggttgatcgaaggagcgccgcacgtcctcttg
tttgatacgggcagcgtgtactcgaggttggacgagtggaagggagacctctggaatctc
gcagggattccgaccccaccgaacgatcacgaaacgaacgagactatcgtctttggttat
ctcgtagcgtggttccttggcgaatatgtcgctcgtcagcggcacactgccgtcatcgct
cattttcacgagtggcaagctggcctagcgatcccactttgccgcaagcggcagatcgac
gtaacaaccgtcttcactacccacgctacccttctgggcaggtacctatgtgccggctcc
gtcgacttctataataacctgcaatacttcgatgtcgaccatgaagcgggcaagcgtggc
atttaccatcgctactgcatcgagcgatcctccgctcattgcgctgatgtcttcacgacc
gtctcgcatatcacggcttacgaatccgagcatttactcaagcgcaagcccgatggggta
cttcctaacggtctcaacgtcgtcaagttccaagccatgcacgaattccagaatttgcat
tcaaccgcgaaagcaaagattaacgagttcgtccgcggccacttctatggccattacgac
ttcgatatcgacaacactttatatttctttacggccgggcgttatgagtaccgcaacaag
ggcgtcgacatgttcatcgaggcgctggcccgtctgaatttccgacttcagaaagcaggg
tcgaagactaccgtcgtggcattcatcatcatgcctgctgcaacagcgtcatacaccatc
gagtctctcaaaggtcaggctgtcaccaagcagctgcagagcaccgtgaacgagatcacg
actcggatcggtcagcgccttttcgaacatgcggcgcgctccaacggggatcatggcacg
aaccccctccccgacgacctcctttccgaggaagacaaagttactcttaagcgccgtatc
tttgctctcaaacgcaatgccctcccgccaatcgtcactcacaacatggtggatgacgcc
aacgacccgatcctgaatcaactccgcagggtaaagttattcaacgcttcctacgatcga
gtcaagattgtcttccatcccgacttcttgaactccaacaaccctatcctaggtctcgat
tacgaggagtttgtacgtggttgccatctaggagtttttccgagttactacgagccctgg
ggctacacccccgcggagtgcaccgtaatgggtattccttccgtcaccaccaatctctct
gggttcggctgctttatgcaagatctcatcgatcgaccgcaagatgaaggttgctatatc
gttgaccgtcgctctcggtccgtggaagagtcagttacggaattgacggagaatatgttc
tccttctgcaacaagacacgtcggcagcgcatcaaccagcgtaaccgcgtcgagcggctt
tcgcctctcctcgactggaaaaacctcggaatcgagtactctaaggcgcgccagctcgct
gttcgccgtgcgtatcccgatgcattctacgggagcgcggagggcgacgacgaattctac
tttacgggagcacagaagatcgatcccatcagcgtgccggccagtccgaggttccggggc
tttggaggactggctacccctggggatcttgggacgctcacggaagagatgcagcgcttg
gccacgagcgattacaatggtggcggttatcagtggcctggcggcgaagaggaagaagat
tcgtacccattcccgttggtcatgaaagttcgctcgcgcgcgtcgtccatcatgtccggt
gccagcacaccaggtggcggcgccttccgcagcctgaacgagcacgacctgcgaaaggca
gacgcggctctttcgcatgtgcaggttgatgcggctctcgcggaagcccacggcgttaat
acctccgagaatgggtccaacgcgcatgcaaacggtgtcaacggtacatcatga

DBGET integrated database retrieval system