KEGG   Punctularia strigosozonata: PUNSTDRAFT_62767Help
Entry
PUNSTDRAFT_62767  CDS       T03131                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
psq  Punctularia strigosozonata
Pathway
psq03030  DNA replication
psq03410  Base excision repair
psq03420  Nucleotide excision repair
psq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PUNSTDRAFT_62767
   03410 Base excision repair
    PUNSTDRAFT_62767
   03420 Nucleotide excision repair
    PUNSTDRAFT_62767
   03430 Mismatch repair
    PUNSTDRAFT_62767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psq03032]
    PUNSTDRAFT_62767
   03400 DNA repair and recombination proteins [BR:psq03400]
    PUNSTDRAFT_62767
Enzymes [BR:psq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PUNSTDRAFT_62767
    6.5.1.6  DNA ligase (ATP or NAD+)
     PUNSTDRAFT_62767
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PUNSTDRAFT_62767
DNA replication proteins [BR:psq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PUNSTDRAFT_62767
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PUNSTDRAFT_62767
DNA repair and recombination proteins [BR:psq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PUNSTDRAFT_62767
   NER (nucleotide excision repair)
    Other NER factors
     PUNSTDRAFT_62767
   MMR (mismatch excision repair)
    Other MMR factors
     PUNSTDRAFT_62767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 18884610
NCBI-ProteinID: XP_007381368
JGI: 62767
LinkDB All DBs
Position
Unknown
AA seq 856 aa AA seqDB search
MSKRTTSGQSTPRKKPKLTSGQNSLDRFFHSSPRKTATGGRQETESNPKGKHKLKADCAA
EIIDVDLLDDPPAPSSHRTSTVQPAVPRSPTPKTAAKFSGLTLSSITLDSGSAVPGYSIL
DIDPLSLDLTACPWRSSSPAPFSFLTHLFATLSQTRSRIRILNTITNGLRMLLRYDAASL
LPALWLLSNTLSPPYSAVELGLGPAVLHRAIQHISGLTSAALKTLYNKHGDPGDVAFEAK
SNVRTLLPHPPLTITGVHGGMLKIASAKGEGAAKQKQAIVEKLLIAAKGEETRYLVRSLC
QNNRVGAARITVLTALARSIVLTSPPTLNISIAGESRYHASAELLAQAICDDESADEARK
RIGAQMTESEALIKKTFVQRPDYNAIVSALLEGGLDGIIDRVPLAVGESFCRPSPEFYWL
IPIAGIPLHPTLGSPTRSLDEIYERFEDLPFVAEFKYDGQRAQVHVWAEPGVTHVKIFSR
HLEDMTEKYPDVVALMNHIYETSPDKESFILDAEVVAVDAEDGSIRSFQELSNRARKVQS
SAEVKIAVCVFAFDLMYLNSKVLLCEPFRKRRELLHTHFTPFVPLGPGIARFDHVESCGS
EQGRDYVEEFWQQAVESRCEGLMIKACMFGEVHDGTGPHQSKSRRKPLPATYEPDKRTSA
WLKLKKDYVSGLGDSLDLVPVGAWHGNGRKAQWWSPILLAVRDASTGQLVAMCKCMSGFT
DTFYKALREKYAPGSDNCASRNIWQVETGGLKPEVYFKPVEVWEIRGADVTLSPVSVAGI
GMISSRGCSLRFPRFIKIRIDKTTEEASTAEFLVQMYKDQQARGKDQTGADEGDLVDVDY
ESVEEADDDSANGGEG
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgaacgacgagcggacaatctacgcctcgcaaaaagcctaagctcacgtca
ggtcaaaatagtctagatagattctttcactcttccccacgcaagacggccacaggcggt
cggcaggaaaccgagagcaatccgaagggcaagcacaagctcaaggcagactgcgctgct
gagatcatagacgttgacctcttggacgaccctcccgctccgagttcgcacaggacatcc
accgttcaacctgcagtaccccggtcaccaacaccgaagacagcagccaagttctcgggg
ctcactctctcgtctatcacgttagactcaggatctgccgttcctggatattccatcctt
gacatcgaccctctatccctcgatttgactgcatgcccatggaggtcctccagccctgcc
ccgttctcctttctaacccatctcttcgccacattatctcagacgcgctcacgaatccgc
atattgaataccatcacgaatgggttgcgtatgctgctccgatatgatgcggcctctttg
ctgcccgccctctggcttctttcaaacaccctatcaccgccatattccgccgtggaactc
ggactaggaccagcggtgctccatcgcgccattcagcatatctctggtctcacgtccgct
gcgctgaagaccttatacaataaacatggtgatccaggggacgtcgcatttgaggccaag
agcaacgttagaactctacttccccatcccccgttgaccattactggcgtccatggagga
atgctgaaaattgccagcgcgaaaggagaaggcgctgcgaaacagaagcaggccatcgtt
gagaagctgctcatcgccgcgaagggcgaggaaacacgctatctcgtccggtcgctctgt
caaaataaccgggtgggagcagcgcgcatcactgtactcacggcgctcgcacgcagcatt
gtgctcacctccccgccaacactcaatatatctatagcaggcgaatctcgatatcatgca
tccgccgagctactagctcaggctatatgtgacgacgagagcgcggacgaggcacgaaag
cgtatcggcgcccagatgactgaatccgaagcgctcatcaagaagacgttcgtgcaaaga
cccgactacaatgcaatcgtgtccgcgctcctggaggggggcctagacggcatcatagat
cgggtaccgctggctgttggcgagtcattctgcaggccgagtccagagttctactggctt
attcccattgcaggcatcccgctacatccgacactcggctctcccacgcgttcgcttgac
gaaatctacgagcgatttgaagacttgccgtttgtggcggagttcaagtacgatggacag
cgtgctcaggtacatgtatgggccgaacctggcgttacccacgtcaagatattttctcgg
cacctcgaggacatgacggaaaagtacccagacgtcgttgccctgatgaaccatatatac
gagacatctccggataaggagtcgttcattctggacgctgaggttgtggctgtagatgcc
gaagacggatctatccgttcatttcaagagctatcgaatagggcgcgtaaggtgcagtca
agcgctgaagtcaagatagccgtatgtgtcttcgcgttcgacctcatgtatctgaattcc
aaggtcctgctctgtgaaccctttcgtaaacgtcgagaactccttcacacgcatttcact
cctttcgtgcctttggggccagggatcgcgaggttcgatcacgtagaaagctgcggtagc
gaacaaggaagggattatgtcgaagagttttggcaacaagccgtggaaagccgctgtgag
ggcctgatgatcaaggcatgtatgttcggcgaagttcatgatggaaccggccctcatcaa
agcaaatctcgacgcaagcccttgcctgcaacgtacgagccagacaagaggacgtcggca
tggctcaagttaaagaaggattacgttagtggtttaggtgattctctggacctggtgccg
gtaggtgcatggcatgggaacggtaggaaagcacaatggtggtcgcctatcttactcgcc
gtgcgggacgcttccaccggacagcttgttgccatgtgcaaatgcatgtcaggtttcacg
gatacattctataaggccctgcgggagaagtatgcacccggatcagataattgcgcgtcg
agaaacatctggcaagttgaaaccggcgggctcaagcctgaagtctacttcaaaccagtc
gaagtctgggaaataaggggggcagatgtaacgctgagtccagtgtcagttgccggtatc
ggaatgatttcctccagaggatgcagtctgcggtttcctcgatttatcaaaattcgtatc
gataagactactgaggaggcgtccaccgcggagttcctggtgcagatgtacaaggatcaa
caggcaagaggcaaggatcagacaggtgcagatgagggtgatctggtagacgtcgactat
gaatcggtagaagaagcagatgatgactccgccaatgggggtgaaggatag

DBGET integrated database retrieval system