KEGG   Punctularia strigosozonata: PUNSTDRAFT_68348Help
Entry
PUNSTDRAFT_68348  CDS       T03131                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
psq  Punctularia strigosozonata
Pathway
psq00310  Lysine degradation
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    PUNSTDRAFT_68348
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psq03036]
    PUNSTDRAFT_68348
Enzymes [BR:psq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     PUNSTDRAFT_68348
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     PUNSTDRAFT_68348
Chromosome and associated proteins [BR:psq03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PUNSTDRAFT_68348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 18885067
NCBI-ProteinID: XP_007383787
JGI: 68348
LinkDB All DBs
Position
Unknown
AA seq 562 aa AA seqDB search
MRVDASAIIQDQEQTESAKPVDKDGLYACIPPTLDLRESPKSGRGLYVKVAIRRGSSLLS
TRPHVSVLSTPYLSSHCSSCAAPASPERPQLKRCAKCHVVHYCSQKCQNADWKAHKPECD
ALQRWATAAPSPDLAVPEEAVRCLGRMLWQKQRNPSSIWSREIDSMQSHRSSLRPESFES
HAYLAHALVRYLGLDAPEKLASFGLRSAGDVVDLISRFTTNAITLAAPSLTPLGVSVSPA
VALVNHSCAPNAVVVFPRVSKTVDQEPVMQVIALRDIHPDEEVTTAYIDTTVPREQRQKI
LRDTYHFTCSCSLCAAEDPDPRESIWCPKRCGGTCSFPTEAVPLPRCLKCKAAFPSTGAI
ADAIRVGQEALDKATSLQFSDPSRALHLTSNTLPLLLSHGLAPGAHPLLALARLHQALLI
DALSGSGSGSGSPSEAQEKLDETVRVAARTCAGLEAVLRAGHPVRAVALAELGKLLAADE
PQPPPSAEDAFPPHGPPRLRLAHGTLLRALEELRIGFGGRNAGGEVGGEVREWVARLEKE
MGVWRRGVRDALEDVPARASGS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttgacgcttccgcaatcatccaggatcaggagcagacagaatcagcaaagccg
gtggacaaggatgggctgtacgcctgcataccgcccacgctggacctgcgcgagtccccg
aagagcggtcgaggattgtacgtgaaggtggctatccgacgaggctcatcgctgctctcc
actcgcccgcacgtctccgttctctctaccccgtacctatcctcccactgctcctcgtgc
gccgcaccggcatcccctgagcgtcctcagttgaaacgatgcgccaagtgtcacgttgtc
cactactgtagccagaaatgccaaaacgccgactggaaagcgcacaagcccgaatgcgac
gccctccagcgatgggccaccgccgcgccgtccccagacctcgcggtgcccgaagaagcc
gtgcgatgcctcggcagaatgctctggcagaaacagcgcaacccgtcgagcatctggtcg
agagagatcgacagcatgcaatcccacagatcgtctctccgccccgagtccttcgaatcg
cacgcttacctcgcccacgcgctcgtgcgctacctcggcctcgacgcccccgaaaagctc
gcgtccttcggcctccgctccgcgggcgacgtcgtcgacctcatctcacgcttcacgacg
aacgcgatcaccctcgccgcgccctcgctcaccccgctcggcgtctccgtctcgcccgcc
gtcgcgctcgtcaaccactcgtgcgccccgaacgccgtcgtcgtcttcccgcgcgtgtcc
aagaccgtcgaccaagagccggtgatgcaagtcatcgcgctgcgggacattcaccccgac
gaagaggtcacgacggcgtacatcgacacgaccgtcccgcgcgagcaacgccagaagata
ctgcgggacacgtaccactttacctgctcttgctctctctgcgcggctgaagacccggac
ccacgcgaatcgatctggtgtccgaagcgatgcggcgggacgtgctcattcccgaccgaa
gcggtcccgctgccccgctgcctcaagtgcaaagcggccttcccgtccaccggcgcgatc
gcggacgccatccgcgtcggccaggaggcgctcgacaaagcgacgtccctgcagttctcc
gatccctcccgcgcgctgcacctgacgtcgaacacgctccccctccttctctcgcacggc
ctcgcgcccggcgcgcacccgctcctcgccctcgcgcggctgcaccaggcgctcctcatc
gacgcgctctccggctccggctccggctccggcagcccgagcgaggcgcaggagaagctg
gacgagacggtgcgcgtcgccgcgcggacgtgcgccgggctcgaggcggtgctgcgcgcg
ggccaccccgtgcgcgccgtcgcgctcgccgagctgggcaagctgctcgccgcggacgag
ccccagccgcccccgtcggcggaggacgcgttcccgccgcacgggccgccgcgcctgcgc
ctcgcgcacggcacgctcctgcgcgcgctggaggagctccggatcgggttcggggggcgg
aacgcggggggcgaggtcgggggcgaggtgagggagtgggtggccaggctggagaaggag
atgggcgtgtggaggcgcggcgtgcgcgatgcgttggaggacgtgcccgctcgcgcatcg
gggtcctag

DBGET integrated database retrieval system