KEGG   Punctularia strigosozonata: PUNSTDRAFT_95460Help
Entry
PUNSTDRAFT_95460  CDS       T03131                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psq  Punctularia strigosozonata
Pathway
psq00250  Alanine, aspartate and glutamate metabolism
psq00410  beta-Alanine metabolism
psq00430  Taurine and hypotaurine metabolism
psq00650  Butanoate metabolism
psq01100  Metabolic pathways
psq01110  Biosynthesis of secondary metabolites
Module
psq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PUNSTDRAFT_95460
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PUNSTDRAFT_95460
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PUNSTDRAFT_95460
   00430 Taurine and hypotaurine metabolism
    PUNSTDRAFT_95460
Enzymes [BR:psq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PUNSTDRAFT_95460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18886703
NCBI-ProteinID: XP_007378907
JGI: 95460
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MALSKHINPERLLQASQDKRSKGHSHYLTQTDPSISFHGYGSRYGAEPVPKFRIPTKGSD
ADAAYQIIHDELSLDGTPLLNLASFVHTWMPPQADKLMQENISKNLIDQDEYPMTQLIHT
RCISMLADLWHAQHAQQAIGTATTGSSEAIQLGGLAMKRIWQAKRKAAGKSIHEPGPNIV
MGANAQVALEKFARYFEVECRLVPTSVESNYCLDPKKAMEYVDENTIGVYVILGSTYTGH
YEPVQEMSDLLDEYEAKTGHSVPIHVDGASGGFIAPFATPKLKWDFQIPRVVSINTSGHK
FGLCYAGVGWVIWRDKAHLPKDLIFELHYLGSVEYSFSLNFSRPAHPIIAQYFNLLHLGF
DGYRRVALQDLKNARLLSRALEASGYYMVLSDIHRPTGTAGSSLVQSAANRMGLKEDDVE
SYCPGLPVVSFRFTDEFKAKYPDIQQKWMQTLLRAKGWIVPNYELAPNLEQIEILRVVVR
ENMTEELIDRLVTDIIEITEGLTKTDNSLHQLVALHASGSAARRPVEKLEEGSGSKSNGT
YAKPC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggctctatccaagcacatcaaccccgagcgtctgttgcaagcgtcgcaggacaagaga
tccaagggacattctcactacctcacgcagaccgatccgtccatctcgttccatggatat
ggatccaggtacggcgctgagccagtgcccaagttccgcattcctacaaagggatccgac
gcggatgcggcgtatcagatcatacacgacgaattgagtctcgatggaacaccgctactc
aatctcgcctcgtttgttcatacctggatgcctccccaggcagataagctgatgcaagag
aacatctccaaaaatctcatcgaccaggacgagtatccgatgacgcagcttatccacacg
cgttgcatcagcatgttggccgacctttggcatgctcagcacgctcagcaagccattggt
actgctactactggctcttccgaagccattcaactcggaggtttggcaatgaaacgcatt
tggcaggctaagcgcaaggctgcgggaaaaagcatacacgaacctggccctaacattgtg
atgggagccaacgcgcaggtagcattggagaagtttgcgagatacttcgaagtggaatgc
cgtctcgttccgacttcggtggaaagcaactactgtctcgatcctaagaaggcgatggag
tacgttgacgagaacactatcggtgtttacgtcattttgggaagtacttacactgggcac
tacgaaccggttcaggagatgagtgacttactggacgagtacgaggccaagaccggccac
tccgtaccaattcatgtcgatggtgccagcggcggcttcattgctccattcgccacgcca
aagctcaaatgggacttccagatcccccgtgtcgtttctatcaacacctcgggacacaaa
ttcggtctctgctatgctggtgtgggatgggtgatctggagggacaaggcgcatctccca
aaagatctcatcttcgagctacactatctcggctcggtggagtattcgttctctttgaat
ttttcacgacctgcgcaccccatcatcgcgcaatacttcaacctgttgcacctcggtttt
gacggctaccgcagagttgcattgcaagacttgaagaatgcccgccttctttcgcgcgct
ctcgaggccagcggatattatatggtgctctctgacattcaccgcccaacgggcactgca
ggcagcagtctcgttcagagtgcggccaacagaatgggcctgaaagaggacgatgttgag
agctactgcccaggactgccggtcgtttcgttccgattcaccgacgagttcaaggccaaa
taccctgacatacaacaaaagtggatgcaaaccctccttcgtgccaaaggatggattgtc
ccgaactatgaactggccccgaacctcgagcaaatcgagatccttcgtgtcgtagtccga
gaaaacatgaccgaggagctcattgatagactcgtcaccgatatcattgaaatcactgag
gggttgaccaagacggacaattccttgcaccagctcgtggcccttcacgcgtctggttct
gctgcccgtcgtccggtggagaagctcgaggaagggtctggtagtaagagcaacggaaca
tacgcaaagccgtgctaa

DBGET integrated database retrieval system