KEGG   Punctularia strigosozonata: PUNSTDRAFT_99938Help
Entry
PUNSTDRAFT_99938  CDS       T03131                                 

Definition
(RefSeq) xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
psq  Punctularia strigosozonata
Pathway
psq00040  Pentose and glucuronate interconversions
psq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PUNSTDRAFT_99938
Enzymes [BR:psq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     PUNSTDRAFT_99938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 18887059
NCBI-ProteinID: XP_007381940
JGI: 99938
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MSDNPSFVLKAIEQTVYEDRPIPEIAPHEVLVAIKKTGICGSDVHYLTHGRIGDFVVNAP
MVLGHESAGIVTKVGAKVKGLKVGDRVALEPGATCRSCDACKAGRYELCPDMVFAATPPY
DGTLARYYAIPGDLAYKLPDNMTLEDGAMIEPLSVGVHSVAAIGQLRANQTCVVFGCGPV
GLVCMAVARALGARRVIAVDIVPHRLEFAKSYAATDIYLPIPLNPGESRIEYSRRNAAAM
KEKLGIQDLGPDGIDLVVDASGAEASIQTGILIAKAGGTYVQVGMGMPDVVIPITLLLTK
EVKFLGSFRYGPGDYQLAIALVAAGKIDLKSLITHRFSFEEAVTAFQVTKAGKSEDGKGV
IKAVISGPGVKVDEL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacaacccatctttcgtactcaaggcgattgagcagaccgtctacgaagacagg
cctatccctgaaatcgcgcctcacgaagtgctcgttgctatcaagaagacagggatatgt
ggctctgatgtgcattacctcacgcacggccgcatcggtgacttcgtggtgaacgcgccc
atggttttgggtcatgagtccgctggtatcgtcacgaaagttggcgcgaaggttaaaggc
ttgaaggttggcgatcgagtcgctttggagcctggggcaacttgccgctcttgtgacgcc
tgcaaggcaggcagatacgaactctgcccggatatggtctttgcagccacacctccttac
gacggtactttggctcgctactatgccatccccggcgatcttgcctataagctccccgat
aacatgactctcgaggacggtgccatgattgagcccttgtccgtgggcgtgcattccgta
gccgctattggccagctacgggccaatcagacttgcgtagtgttcggatgcggcccggta
gggctggtttgcatggccgttgctcgtgcactcggtgcgcggagagtgattgccgtagac
attgttccccacagacttgaattcgccaagtcatatgccgcaaccgatatatacctcccg
attcccctgaacccgggagagagccggatcgagtactcccgacgcaatgccgccgcaatg
aaggagaagctcggtattcaggatcttggtcctgacggtatcgacctggttgtggatgcc
agtggtgccgaggcatctatccagactggtatcttgattgccaaggcaggagggacatat
gtgcaggttggtatgggcatgcctgatgtcgtgattcccattactctcctgctcaccaag
gaggttaagttcctcgggtccttccgctacggcccgggcgactatcaacttgcgatcgcg
ctcgtagcggccggaaagatcgaccttaagtccctcatcacacaccgcttctcattcgag
gaagccgtgaccgcgttccaggtcaccaaggcgggcaagagcgaggacggaaaaggcgtt
atcaaggcagtcatctctggcccaggcgtgaaggtggacgagctctag

DBGET integrated database retrieval system