KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2289Help
Entry
PSTAA_2289        CDS       T01976                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00061  Fatty acid biosynthesis
psr00780  Biotin metabolism
psr01100  Metabolic pathways
psr01130  Biosynthesis of antibiotics
psr01212  Fatty acid metabolism
Module
psr_M00083  Fatty acid biosynthesis, elongation
psr_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSTAA_2289
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSTAA_2289
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PSTAA_2289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psr01004]
    PSTAA_2289
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PSTAA_2289
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PSTAA_2289
Lipid biosynthesis proteins [BR:psr01004]
 Fatty acid synthase
  Component type
   PSTAA_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF2102
Motif
Other DBs
NCBI-ProteinID: AEA84177
LinkDB All DBs
Position
2460197..2460991
Genome map
AA seq 264 aa AA seqDB search
MGFLTGKRVLIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLKGRVEEFAAGWGSSPE
LCFPCDVANDEDIARVFEELGKKWDGLDCIVHSVGFAPGDQLNGDFTEVTTREGFKIAHD
ISAYSFVALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSL
GPEGTRVNCISAGPIRTLAASGIASFRKMLAANEKQTPLRRNVTIEEVGNAGAFLCSDLA
SGISGEILYVDGGFNTTAMGSLED
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctcaccggtaagcgcgtactgatcgtcggcgttgccagcaaactgtcgatt
gcctcgggcatcgccgccgccatgcatcgcgaaggtgcagaactggctttcacctaccag
aacgacaagctcaagggccgcgtcgaggaattcgccgccggctggggctcgagcccggag
ctgtgctttccctgcgacgtcgccaatgacgaagacatcgcccgcgtgttcgaggagctg
ggcaagaagtgggacggcctggactgcatcgttcactccgtcggcttcgccccgggcgac
cagctgaacggcgacttcaccgaagtcaccacccgcgaaggcttcaagatcgcccacgac
atcagcgcctacagcttcgtcgccctggccaaggccggtcgcgagatgatgaagggccgc
aacggcagcctgctcacgctctcctacctgggcgccgagcgcaccatgccgaactacaat
gtgatgggcatggccaaggccagcctggaagccggtgtacgctacctggctggcagcctt
ggcccggaaggcacccgcgtcaactgcatctccgccgggccgatccgcaccttggcagcc
tccggcatcgccagcttccgcaagatgctcgccgccaacgagaagcagaccccgctgcgc
cgcaacgtcaccatcgaggaagtcggcaatgccggtgccttcctctgctcggacctggcg
tccggcatcagcggtgagatcctttacgtcgacggcggcttcaacaccaccgcgatgggc
tcgctggaagactga

DBGET integrated database retrieval system