KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2496Help
Entry
PSTAA_2496        CDS       T01976                                 

Gene name
dacB
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSTAA_2496 (dacB)
Enzymes [BR:psr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PSTAA_2496 (dacB)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     PSTAA_2496 (dacB)
Peptidases and inhibitors [BR:psr01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   PSTAA_2496 (dacB)
Peptidoglycan biosynthesis and degradation proteins [BR:psr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PSTAA_2496 (dacB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 SdpA
Motif
Other DBs
NCBI-ProteinID: AEA84377
LinkDB All DBs
Position
2677466..2678923
Genome map
AA seq 485 aa AA seqDB search
MNRILRGISLAVLAFPIALPLHAAGVNQTLPARVEQALKANKINNDALSVVMLPLTGNAA
PTIVNADVSVNPASTMKLVTTYAALELLGPNHQWKTEFYADGPLVDGVLNGNLYLKGGGD
PKLNMEKLWLLLRDLRANGVSKVTGDLVLDRSHFVQPDLPVFDDDGGDQNKPFLVGPDSL
LVNLKALRFIVRNDGGKVNVAVEPPIASVRIDNRVQALPAAKCPGWPEVLYNPVADGDGV
TVVVTGKLAAGCSAQTYLSLLDHERYAAGAVRAIWGELGGSILGTDRVAQVPSSARLLAR
AYSPDLTEIIRDVNKYSNNTMAKQLFLSLGAAFRNEADADDAKAAQRVIRQWLAKKGLIS
PHLVIENGSGLSRAERVSARELASLLQAAWRSPYSAEFISSMPLAAVDGTMRKRLRNTPV
AGKAHVKTGTLNTVRAIAGYSRDGDGNVWAVVAILNHPRPWGASSILDQVLVSLYNQRSE
STAQR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatccttcgtggtatctccctggccgttctggccttccccattgcgctgccg
ctccatgcggccggcgtgaaccagacgctgccagcccgtgtggagcaggcgctcaaggcc
aacaagatcaacaacgacgcgctgtcggtcgtcatgctgccgcttaccggcaacgcggca
ccgacaatcgtcaatgcagacgtatcggtcaatcccgcctcgaccatgaaactggtcacc
acctacgccgcactcgaactgctcgggccgaatcatcagtggaaaaccgagttctatgcc
gacggtccgctggtggatggcgtgctcaatggcaatctttatctgaaaggtggcggcgat
cccaagctgaacatggagaagctctggttgctgctgcgtgatctgcgcgccaacggtgtg
agcaaggtcaccggcgatctggtgctggatcgcagccacttcgtccagcccgacctgccg
gtattcgacgatgacggcggcgaccagaacaagccgttcctggtcggccccgattcgcta
ctggtcaacctcaaggcgctgcgcttcatcgtccgcaacgatgggggcaaggtgaacgtg
gcggtggagccgcccattgccagcgtccgcatcgacaaccgcgttcaggccttgccggca
gccaaatgcccaggctggccagaggtgctgtacaaccccgttgccgacggcgacggggtc
accgtggtggtcacgggcaagctcgccgctggttgcagcgcgcagacctatctttccctg
ctggaccacgaacgctatgccgcaggcgcggtgcgggcgatctggggcgaactcggcggc
agcatcctgggcactgatcgtgtcgcccaggtaccgagcagcgcccgcctgctggccagg
gcctactccccggacctcaccgagatcattcgtgacgtcaacaagtacagcaacaacacc
atggccaagcagctgttcctgagcctgggtgcggcgttccgcaacgaagcggatgccgat
gacgccaaggcggcacagcgagtgatccgccaatggctggccaagaaagggctgatttcc
ccgcacctggtgatcgaaaacggctccggcctttcccgtgccgagcgggtcagcgcgcgt
gaactggcgagtttgctgcaggccgcctggcgcagcccctactcggccgagttcatctcc
tcgatgcctttggcggccgtggacggcaccatgcgcaagcgtctgcgcaacacgccggtc
gccggcaaggcacacgtgaagacgggcacgctgaataccgtgcgcgcgatcgcgggctac
agtcgagacggcgacggcaatgtctgggcggtggtggcgatcctcaaccacccacgtcca
tggggcgcctcgtcgatcctggatcaggtgctggtcagcctgtacaaccagcgcagcgaa
agcaccgctcagcgctga

DBGET integrated database retrieval system