KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2579Help
Entry
PSTAA_2579        CDS       T01976                                 

Gene name
gstA
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSTAA_2579 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psr02000]
    PSTAA_2579 (gstA)
Enzymes [BR:psr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PSTAA_2579 (gstA)
Transporters [BR:psr02000]
 Other Transporters
  Pores ion channels [TC:1]
   PSTAA_2579 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AEA84460
LinkDB All DBs
Position
2770206..2770877
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNHSRSHRVLWMLEELELLYELKRYGRDPKTMLAPPELKAVHPLGKSPVITDGD
LTLAESAAILEYLLERYANGRLMPAQGSADYRRFRYWMHYAEGSAMPPLLLKLVFDRVAS
GPMPFFIKPVARAIANGAHKAFIGPQLKTHLDYMEAELEKSPWFAGDSFSAADIQMSFPL
EAARSRAGLDQSRPRLLDFLERIQQRPAYQRAVESGGPALPTA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgtccaccacctgaaccattcccgctcgcaccgcgtgctctggatgctggag
gaactggagctgctgtacgagttgaagcgctacgggcgcgatccgaaaaccatgctcgct
ccgccggaactgaaagccgttcacccgttgggcaaatccccggttatcactgacggtgac
ctgaccctggcagagtcggctgcgattctcgaatacctgctggagcgctacgccaacggt
cggctgatgccggcccagggaagcgccgactaccgacggtttcgctactggatgcattac
gcggaagggtcggccatgccgccgcttctgctgaagctggtgttcgaccgggtcgccagc
gggccgatgccgtttttcatcaagccggtagcccgtgccatcgccaacggcgcgcacaag
gcgttcatcggtcctcaactgaagacgcatctggactatatggaagcggagctggagaaa
tccccctggttcgcaggagacagcttcagcgcggcggatattcagatgagctttccgctc
gaagcggcacgctcgagagcggggctggaccagagccgcccgcgcctgttggactttctc
gaacgcatacagcaacggcccgcctatcaacgagccgtcgaaagcggcggaccggccctg
cccaccgcgtga

DBGET integrated database retrieval system