KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2867Help
Entry
PSTAA_2867        CDS       T01976                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00620  Pyruvate metabolism
psr00680  Methane metabolism
psr01100  Metabolic pathways
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTAA_2867 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    PSTAA_2867 (ppc)
Enzymes [BR:psr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PSTAA_2867 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEA84746
LinkDB All DBs
Position
complement(3057856..3060495)
Genome map
AA seq 879 aa AA seqDB search
MAKIIDARLRDNVHLLGELLGNTIRAQHGDQFFDKIERIRKGAKAARKGSAEGAQLLAET
LDSLDESELLPMTRAFNQFLNLANIAEQYHQVRRRAAGEPAPFEIGVFADLIERLKAAGH
DNEFIARQVSRLEIELVLTAHPTEVSRRTLIQKYDAIAQQLAARDHTDLSDAERASIELS
LQRLIAEVWHTEEIRRNRPTPVEEAKWGFAAIENSLWKAVPNVLRQTDATLHRLTGLHLP
LEAAPIRFASWMGGDRDGNPNVTAMVSREVLLTARWVAADLYLREIEGLITALSMREASD
ELLRQSGDSAEPYRVLLKPLRQRLRATREWARAAIEHGQPAPAEVLQDCAELRRPLELCY
RSLHACGMGVIADGALLDCLRRLAVFGLFLVRLDIRQDAARHAAALAEITDYLGLGDYQQ
WDEQKRLDWLQHELANRRPLLPAHYHPSADTAEVLATCAVIAEAPAASLGSYVISMAHAA
SDVLAVQLLLKEAGLQRPMRVVPLFETLDDLNNAAPTIDRLLSLPGYRQRLHGPQEVMIG
YSDSAKDAGTTAAAWAQYRAQEQLVEVCREHGVELLLFHGRGGTVGRGGGPAHAAILSQP
PGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPEPGWRETMDRL
AAEGVAAYRGVVREHPLFVDYFRQATPELELGRLPLGSRPAKRREGGVESLRAIPWIFAW
TQTRLMLPAWLGWEQALHGALQRGEGERLAEMRARWPFFSTRIDMLEMVLAKADADIARR
YDERLVQPELLSLGSDLRDRLSQVIEAVLSLTGQSDLLDHSPKTQEAFSLRNTYLDPLHL
MQIELLARSRQRQGPAESPLEQALLVSVAGIAAGLRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcatcgatgcgcgcctgcgcgacaacgtacacctgctcggcgaactgctg
ggcaataccatccgcgcgcagcatggcgatcagttcttcgacaagatcgagcgcatccgc
aagggcgccaaggctgcgcgcaagggctcggcagagggcgcacagctgctggccgaaacg
ctcgacagtctcgacgagagcgaactgctgcccatgacccgggcgttcaaccagtttctc
aatctggccaatatcgccgagcagtatcatcaggtgcgccggcgcgccgcaggcgagccg
gcgccgttcgagatcggggtgttcgccgatctcatcgagcgtctcaaggcggctgggcac
gacaacgagttcatcgcgcggcaggtcagccgcctggaaatcgaactggtgctcaccgcg
catcccaccgaggtatcgcgccgcacgctgatccagaagtacgacgccatcgcccagcag
ctggcggcacgggatcacaccgatctctccgacgccgagcgggcgagcatcgagttgagc
ctgcagcgcctgatcgccgaggtgtggcacaccgaggagattcgtcgcaaccggccgacc
ccggtggaggaggccaaatggggtttcgctgccatcgagaattcgctgtggaaggcggtg
cccaacgtgctgcgccagaccgacgcgaccctgcaccgcctcaccggcctgcacctgcca
ttggaggccgcgccgatccgcttcgcctcctggatggggggcgaccgcgacggtaacccg
aacgtcaccgcgatggtatcgcgcgaggtgctgctgaccgcccgttgggtggccgccgat
ctctacctgcgcgagatagaagggctgattaccgcgctgtccatgcgcgaggccagtgat
gaactgctgcgccagagcggcgactcggccgagccctatcgcgtcttgctcaagccgctg
cgccagcgcctgcgggcgacacgtgagtgggcccgcgcggccatcgagcacggccagcca
gcgccggcggaagtcctgcaggattgcgccgagctgcgtcgtccgctggagctgtgctac
cgctccctgcacgcttgcggcatgggggtgatcgctgatggcgctctgctcgactgcctg
cgtcgcctggccgtgttcggcctgttcctggtgcggctggacattcgccaggatgcggcc
cgtcatgccgccgcgctggccgagatcaccgattacctcgggctaggcgactatcagcag
tgggatgagcagaagcgcctggactggctacagcacgagctggccaatcggcgcccgctg
ctgccggcgcattaccacccatccgccgataccgccgaagtgctcgccacctgtgcggtg
atcgccgaagcgccagcggcgtcgctgggttcctacgtcatctccatggctcacgcggcc
tccgatgtgctcgccgtgcaactgttgctcaaggaggccggcctgcagcgaccgatgcgc
gtggtgccgctgttcgagaccctcgatgacctgaacaacgcggcaccgaccatcgaccgt
ctgctttccctgccgggctatcgccagcgcctgcatggcccccaggaagtgatgattggc
tactccgattcagcgaaggacgccggcaccacggcggccgcctgggcccagtaccgggcc
caggaacaactggtggaggtctgtcgcgagcacggcgtcgaactgctgctgttccacggc
cgcggcggcaccgtcgggcgcggcggcggtccggcccatgcagcgatcctgtcgcagccg
ccgggctcggtcgccgggcgcttccgcaccaccgagcagggcgagatgatccgcttcaag
ttcggcctgccggatatcgccgagcagaacctcaacctgtacctcgcggcggtgctcgaa
gcgacgctgctgccgccaccgccccctgaacccggctggcgcgagacgatggatcggctt
gccgccgagggtgttgcggcctaccgcggcgtggtgcgcgagcatccgctgttcgtcgac
tacttccggcaggcgacgccggagctggagttggggcgcctgccgctgggcagccggccg
gccaagcgccgcgaaggcggcgtcgagagcctgcgggcgatcccctggatcttcgcctgg
acccagactcgcctgatgttgccggcctggctgggctgggagcaggcgctgcacggggcg
ctgcagcgcggggagggcgagcggctggctgagatgcgtgcgcgctggccattcttcagt
acgcgcatcgacatgctggagatggtgctggccaaggctgacgccgacatcgcgcggcgc
tacgacgagcgtctggtgcagcctgagctgctttcgctgggtagcgatttgcgtgaccga
ttgtcgcaggtcatcgaggcggtgttgagcctgaccggccagtcggatctgctcgatcac
agccccaagacccaggaggcattcagtttgcgcaatacctacctggacccgctgcacctg
atgcagatcgagttgctggcgcgttccaggcagcggcaaggcccggcggagagccccctc
gagcaggccctgctggtcagcgtggcgggcatcgcggccggtctgcgcaataccggctga

DBGET integrated database retrieval system