KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3327Help
Entry
PSTAA_3327        CDS       T01976                                 

Gene name
ahpF-2
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psr  Pseudomonas stutzeri DSM 4166
Brite
KEGG Orthology (KO) [BR:psr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSTAA_3327 (ahpF-2)
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSTAA_3327 (ahpF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 K_oxygenase NAD_binding_8 Glutaredoxin Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AEA85196
LinkDB All DBs
Position
complement(3524555..3526117)
Genome map
AA seq 520 aa AA seqDB search
MLDTNLKTQLKAYLEKVTQPFEIVASLDDGEKSRELLSLLQDIAGLSDKITLKTDGDDAR
KPSFSLNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSRTAPEVIEQIKALDGDYRF
ETYFSLSCQNCPDVVQALNLMAVLNPNVKHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLKAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYEVDIMNLQRASQLIPAGEDGL
HRVRFDNGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEDLRADAVLQRKLNSLPNVRVLKMAQTTEVKGDGQ
KVTGLVYKDRTNDEVHNVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaaatcccgggagctgctgagcctgctg
caggacatcgccggcctcagcgacaagatcaccttgaagaccgacggtgacgatgcgcgc
aagccgtcgttctcgctcaaccgcatcggcggcaacatcagcctgcgttttgccggcatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtcggtggccacccg
tcgaggaccgcaccggaagtcattgagcagatcaaggcgctcgacggcgactaccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggttcaggcgctgaacctg
atggccgtgctcaacccgaacgtcaagcacgtggccatcgacggcgcgctgttccaggac
gaagtcgaagcgcggcagatcatgtcggtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaagaagagatcctcgccaagctcgacaccggttccagcgcc
cgtgatgccgagaagctcaaggccaaggacgccttcgacgtgctggtggtcggcggcggt
ccggccggcgccgcagcggccatctacgccgcgcgcaagggcatccgcaccggcgtcgcg
gccgagcgcttcggcggtcaggtgctggacaccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagagcacgtgcgcgagtacgag
gtcgacatcatgaacctgcagcgcgccagccagctgatcccggccggcgaagacggcctg
caccgcgtcaggttcgacaatggcggcgagctcaaggccaagaccctgatcctcgccacc
ggcgcgcgctggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggtggcaactccggcgtggaagcggccatcgacctggccggcatcgtcgcccacgtgacc
ctgctcgagttcggcgaagacctgcgtgccgacgccgtgctgcagcgcaagctcaacagc
ctgcccaacgtccgcgtgctgaagatggcgcagaccaccgaggtcaagggcgacggccag
aaggtcaccggcctggtctacaaggaccgcaccaacgacgaggtgcacaacgtcgagctg
gaaggcatcttcgtgcagatcggcctgctgcccaacagcgaatggctcaagggcaccctg
gagctgtcccgtttcggcgagatcatcgtcgacgccaagggccagaccagcatccccggt
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtcggc
gagggcgccaaggcctcgctgagcgccttcgatcacctgatccgcagctccgcgccggcc
tga

DBGET integrated database retrieval system