KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_4245Help
Entry
PSTAA_4245        CDS       T01976                                 

Gene name
nasE
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00910  Nitrogen metabolism
psr02010  ABC transporters
Module
psr_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PSTAA_4245 (nasE)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PSTAA_4245 (nasE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psr02000]
    PSTAA_4245 (nasE)
Transporters [BR:psr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    PSTAA_4245 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEA86100
LinkDB All DBs
Position
4566865..4567734
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPASTEPVSIVRPSRAAALMQRSGRYAVQQLLPPLVILLVLGVIWEMLCSGAD
AALPPPSQVIAETWELIVDPFYDNGGNDVGLAWQLLASLERVAVGYLLAVVAGVGLGVLI
GQSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccagcaccgagccggtgtccattgtccgccca
tccagagccgctgccctgatgcagcgtagcggccgctacgcggtgcagcagctgttgccg
ccactggtcatcctgctggtgctcggggtgatctgggagatgctctgctccggtgccgat
gccgcgctgccaccgccttcgcaggtgatcgcggaaacctgggaactgatcgtcgatccg
ttctacgacaacggcggcaatgacgtgggcctggcctggcaactgctggccagcctcgaa
cgggtagcggtcggctatctgctggcggtagtcgccggggtcggcctcggcgtgctgatc
ggccagtcggactgggccatgcgcggcctcgatccgatcttccaggtgctgcgcaccgtg
ccgccactggcctggctgccgctgtcgctggcgggctttcaggacagccatccctcggcg
ctgttcgtcattttcatcaccgcgatctggccgatcatcatcaataccgcagtgggcatc
cgcaacataccgcaggactaccgcaacgtcgcccaggtgctgcagctcaatggcttcgaa
tacttcaagaccatcatgctgccggccgccgcgccctacatcttcaccggcctgcgcatc
ggcgtcggcctgtcgtggctggcgatcatcgccgcggagatgctcatcggcggcgtcggc
atcggcttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtgctcgatcgcctggtggccttcgtcggccag
cgcatcactcgcggcattccggccaactga

DBGET integrated database retrieval system