KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443382Help
Entry
102443382         CDS       T02980                                 

Gene name
SOD2, Mn-SOD
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04068  FoxO signaling pathway
pss04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102443382 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102443382 (SOD2)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102443382 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102443382
NCBI-ProteinID: NP_001303978
Ensembl: ENSPSIG00000007847
UniProt: V9M2Z5
LinkDB All DBs
Position
Un
AA seq 226 aa AA seqDB search
MAMLCRLARRGRNNTKLMLPLGVLASRQKHSLPDLPYDYGALEPHISAEIMQLHHSKHHA
AYVNNLNVTEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPQGE
LMEAIKRDFGSFGNFKEKLTAVSVGVQGSGWGWLGFNQGQGCLQVTACYNQDPLQGTTGL
IPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSARYTACKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctgtgccgcctggcgcgccggggcaggaacaacaccaagctaatgttacct
ttgggagttttggcctctagacaaaaacactctcttcctgacttgccttatgactatggt
gccctggaaccccacatcagtgcagaaatcatgcagctacaccacagcaaacatcatgca
gcttatgtgaataatctgaatgttacagaggagaaatataaagaggcactggctaaaggt
gatgttacagctcaggtgtctcttcagcctgccctaaagttcaatggtgggggtcatatc
aaccacaccatcttttggacaaacctttctcctaacgggggaggtgagcctcaaggggaa
ttgatggaagccatcaagcgtgatttcggctccttcggaaacttcaaggagaagctgaca
gcagtatcagttggtgttcaaggctctggctgggggtggcttggttttaaccagggccaa
ggctgcctgcaggtcactgcttgttacaatcaggaccctctacaaggaacaacaggtctt
attcctcttctaggaattgatgtgtgggagcatgcttattatcttcagtataaaaatgtt
agacctgactatttaaaagctatctggaatgtgatcaactgggagaatgtatctgcgaga
tatacagcttgcaaaaaataa

DBGET integrated database retrieval system