KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443573Help
Entry
102443573         CDS       T02980                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss01100  Metabolic pathways
pss04068  FoxO signaling pathway
pss04070  Phosphatidylinositol signaling system
pss04115  p53 signaling pathway
pss04140  Autophagy - animal
pss04150  mTOR signaling pathway
pss04218  Cellular senescence
pss04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102443573 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102443573 (PTEN)
   04070 Phosphatidylinositol signaling system
    102443573 (PTEN)
   04150 mTOR signaling pathway
    102443573 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102443573 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102443573 (PTEN)
   04218 Cellular senescence
    102443573 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102443573 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pss01009]
    102443573 (PTEN)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102443573 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102443573 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102443573 (PTEN)
Protein phosphatases and associated proteins [BR:pss01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102443573 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 102443573
NCBI-ProteinID: XP_014428208
Ensembl: ENSPSIG00000008864
UniProt: K7FNZ3
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTTKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQ
FVVYQLKVKIFTSPSGPPRREDKYMYFEFPQPLPVCGDIKVEFFHKQNKMLKKEKMFHFW
VNTFFIGLDENSDKVENGSLVGDQELDGIFSTERSDNDKEYLILTLTKNDLDKANKDKAN
RYFSPNFKVKLFFTKTVEEPSNPEASSSASVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgcagagagacttgaaggagtataccgaaacaacattgatgatgtagta
aggtttttggattcaaaacataaaaaccattacaagatatacaatctatgtgctgaaaga
cattatgacaccaccaaatttaactgcagagttgcacagtatccttttgaagaccataac
ccaccacagctagagcttatcaaacctttttgtgaagatcttgaccaatggctaagtgaa
gatgacaatcatgttgcagcaattcactgtaaagctggaaagggacgaactggtgtaatg
atttgtgcatatttgttacatcgaggcaagtttttaaaggctcaagaagctctagatttc
tatggggaagtaaggaccagagacaagaagggagtaactattcccagtcagagacgctat
gtgtattattatagttatctgttaaagaatcacctggattatagaccagtggcactgttg
tttcacaagatgatgtttgaaactattccaatgttcagtggcggaacttgcaatcctcaa
tttgtggtgtaccaattaaaggtaaagatattcacctctccttcaggacccccaagacga
gaagacaaatacatgtactttgaattccctcaaccattgccggtgtgtggtgatatcaaa
gtggaattcttccacaaacagaacaagatgttgaaaaaggaaaaaatgtttcacttttgg
gtaaatacattcttcataggactggatgaaaattcagacaaagtagaaaatggaagtcta
gttggcgatcaggaacttgatggtattttcagcacagaacgctcagataatgacaaggaa
tacctaatccttacattaacaaaaaatgatctagacaaggcaaataaagacaaagccaac
agatatttttctccaaactttaaggtgaagctatttttcacaaaaacagtagaggagcca
tcaaatccagaggctagcagttctgcttcagtaacaccggatgttagtgacaatgaacct
gatcattatagatattctgacaccactgactctgatccagagaatgaaccttttgatgaa
gatcagcatacgcagattacaaaagtctga

DBGET integrated database retrieval system