KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443627Help
Entry
102443627         CDS       T02980                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102443627 (NKX3-1)
Transcription factors [BR:pss03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    102443627 (NKX3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN KIP1 Homez
Motif
Other DBs
NCBI-GeneID: 102443627
NCBI-ProteinID: XP_025046764
LinkDB All DBs
Position
Unknown
AA seq 176 aa AA seqDB search
MFNSCKNVARMKCALRKEPVNQLYWFLSSCITPLFLPSEAPTETCLSDCENPLRASPSHQ
RAPKQQKRSRAAFSHTQVIELERKFSRQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYK
TKRKQLSSELSELDKNSALPVLREDNPSRASVISVYNSYQYYPCLYYLNGWSPSLW
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagctgtaaaaatgttgccaggatgaaatgtgctctcaggaaagagcctgtg
aaccagctatactggttcctttcctcatgtataactcccctcttccttccctcagaggca
cctacagagacctgtctgtcggactgtgaaaaccctctgagagcctcaccaagtcaccag
agagccccaaagcagcaaaagcggtcgcgggcagccttctcccacacccaggtcatcgag
ttagaaaggaagttcagtcgtcagaaatatctgtccgccccagagcgcgctcacctggca
aagaacctgaagctcacggaaacccaggtgaaaatctggttccagaaccgaaggtacaaa
accaaaaggaagcaactctcctcggagctcagtgaactcgataagaactctgctctcccg
gtcctgagagaggacaacccctccagagcctctgtgatttcggtgtataacagctaccaa
tactatccctgcctgtactacttgaatggctggagtccctctctgtggtaa

DBGET integrated database retrieval system