KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443708
Entry
102443708         CDS       T02980                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04020  Calcium signaling pathway
pss04144  Endocytosis
pss04510  Focal adhesion
pss04540  Gap junction
pss04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102443708 (PDGFRA)
   04020 Calcium signaling pathway
    102443708 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102443708 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102443708 (PDGFRA)
   04540 Gap junction
    102443708 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102443708 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102443708 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pss04090]
    102443708 (PDGFRA)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102443708 (PDGFRA)
Protein kinases [BR:pss01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102443708 (PDGFRA)
CD molecules [BR:pss04090]
 Proteins
  102443708 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set C1-set ECSCR
Other DBs
NCBI-GeneID: 102443708
NCBI-ProteinID: XP_006113545
Ensembl: ENSPSIG00000006648
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPRTFLFLGCLLAGPWLTFCQLPLPTVLPNRDEMVVQLNSSFTLKCSGDSEVTWQYP
MAEGSHRIDIRNEENNSGLFVTLLEVGNASAAHTGLYTCYYNHTQEEDGEVEGKDIYIYV
PDPDMPFVPLLPEDQFILIEDGDSTIIPCRTSDPNAQVVLINSEAKVVYAYYDSKQGFLG
NFPAGSYTCKTTVKGVEFKSDQFFIYILKATSQLPVEIEALQTVHVKGETIVVTCVVFDN
EMVNLQWNYPGKVKEKGVTKVDDIKVPSQKLVYTLTIPEASVKDTGDYECTAQHATKEVK
ENKRVAITVYDKGFIHLDPQFSPLEAVNLHEVKNFIVDVQAYPAPKMIWLKDNVTLTENL
TEIVTSSNKIHETRFQSILKLIRAKEEDSGDYTLVAENGEETKSYTFSLIIQVAASILDL
VDDHHSSGGGQTVQCMAKGTPFPDVDWLICKDIKKCSNDTSWMLLTNNISDIHMEAHRVE
KDQVESQVTFQKVEETLAVRCMARNTLGAVTRELKLVAPTLNSKLTVAAAVLVLLVFVII
LLIVLVIVWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKSKKDFDIFGMNTADESTRSY
VILSFENNGEYMDMKQADTTQYVPMLERKQGSKYSDIQRSLYDRPASYKKKSVSEPEVKN
LLSDDNSDSLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSSFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYKK
SYERIHLDFLKSDHPAVTRMRVDCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPISEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccaaggacattcctgttcctgggatgtctcctggcaggaccctggcta
actttctgccagcttccattgccgactgttcttccgaatagagatgaaatggttgtacag
ctgaattcctcctttaccctgaagtgctctggagacagcgaagtgacctggcagtatcca
atggctgaaggaagccacagaatagacattagaaatgaagagaacaacagtggtctcttt
gtgactttgctggaagtggggaatgcctcagctgctcataccggattatatacttgttac
tacaatcatacccaagaggaggacggagaggtggaggggaaggatatctacatctatgtg
cctgatccagatatgccctttgttcctctacttccagaggatcaattcatcctaatagaa
gacggagattcgaccattatcccttgtcggacaagtgaccctaatgctcaagtagtttta
attaacagtgaagccaaggtcgtatatgcctattatgacagcaaacaagggttcctagga
aattttcctgcaggctcatacacatgcaaaacaactgttaaaggagtggagttcaagtca
gatcagtttttcatctacattttgaaagctacttcacagctgccagttgagattgaggcc
cttcaaactgtacatgtaaaaggagaaacaattgtagtaacttgtgtggtctttgacaac
gagatggttaatttacagtggaattatccagggaaagtgaaagaaaaaggtgtgacaaaa
gttgatgacattaaagttccatctcagaagctggtttacactttgaccattcctgaggct
tcagtgaaagacaccggggattatgaatgtactgcccaacatgcaaccaaggaggttaaa
gaaaataagagagtagcaattacagtttatgataaaggattcattcatctggacccccag
ttcagtcctttggaagcagtcaatttacatgaggtcaaaaatttcatagtggatgtgcag
gcatacccagctccaaaaatgatctggctgaaagacaatgtgactctgactgagaacctt
acagagattgttactagttcaaacaagatccacgagacaagattccaaagtatattaaaa
ctgattcgggccaaggaagaagatagtggagattatactttggttgctgaaaacggagaa
gagactaaaagctatactttctcattgataatacaagttgcagcgtcaattctagaccta
gtggatgatcaccacagctctggagggggacagacagtccaatgcatggcaaaagggaca
cctttccctgacgtggattggctgatttgcaaggacattaaaaaatgcagtaatgatacc
tcatggatgcttctgactaacaacatctcagatatacacatggaggctcatcgggttgag
aaggaccaggtggaaagccaggtgaccttccaaaaggtagaagagaccctggcagtacgg
tgcatggcgaggaacactcttggtgctgttactcgggaactgaagcttgtggctcctaca
ttgaattcaaaattaaccgtggctgctgcagtcctagtgttattagtgtttgtgattatt
ttactgattgtcctggtcatcgtatggaaacagaaaccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatggccatgagtacatttatgtggacccaatgcaattg
ccctatgactcaagatgggagtttcctagagatggattagtacttgggcgaatcctgggt
tcaggcgcgtttgggaaagtggttgaaggaactgcatatggattaagtcgctctcaaccg
gtgatgaaggtagctgtgaaaatgctaaaacccacagctagatccagtgaaaaacaggca
ctgatgtctgaattgaagataatgacacatcttgggccccatttgaacattgtgaatctc
ttaggagcttgtaccaaatcaggtccaatttacatcattactgaatactgcttttatggt
gacttggtaaactacctgcataaaaacagggataatttcctgagccgacatccagaaaag
tcaaagaaggacttcgacatttttgggatgaacacagctgatgaaagcacaagaagttat
gtcattttatcttttgaaaacaatggagaatacatggacatgaaacaagctgatacaaca
cagtatgtgccaatgctggaaaggaagcagggttctaagtattcggatatccagagatcg
ttgtatgatcggcctgcatcatataagaaaaaatctgtgtcagaaccagaagtcaaaaac
ctgctttccgatgacaattctgacagcctcagtctgctggatttactaagcttcacgtac
caagttgcacgaggaatggagttcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtccttctggctcaaggaaaaattgtgaagatctgtgactttggtctggct
agggacatcatgcacgattccaactatgtctccaaaggcagcacttttctcccagtgaaa
tggatggcacctgaaagcatttttgacaacctgtacaccacattaagcgatgtctggtct
tatggcattctgctgtgggagatattttctcttggtggcaccccataccctggcatgatg
gttgattcttctttctacaacaagataaaaagtggctaccgaatggcaaaacctgaccat
gctaccagtgaagtgtatgagatcatggtgaaatgttggaacagcgaaccagagaaaaga
ccttcattttaccatttgagtgaaatcgttgagaatctgttgcctggcgagtacaagaag
agctatgaaaggattcatctggacttcctgaaaagtgaccacccggctgtcacacgcatg
agagtggactgtgacaacacctacatcggtgtcacctacaagaatgaagacaagttaaag
gacagggagagtggatttgatgagcagcgattgagtgctgacagtggctacatcattcct
ctgcctgacattgatcccatctccgaagatgaacttggcaaaaggaacaggcacagttcc
cagacatccgaagaaagtgccattgagactggttccagcagctctacctttatcaagcga
gaggatgagaccattgaggacattgacatgatggacgacattggaatagattcctcagac
ctggtggaagacagtttcctgtaa

DBGET integrated database retrieval system