KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443724Help
Entry
102443724         CDS       T02980                                 

Gene name
MAVS
Definition
(RefSeq) mitochondrial antiviral-signaling protein
  KO
K12648  mitochondrial antiviral-signaling protein
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04623  Cytosolic DNA-sensing pathway
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102443724 (MAVS)
   04622 RIG-I-like receptor signaling pathway
    102443724 (MAVS)
   04623 Cytosolic DNA-sensing pathway
    102443724 (MAVS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102443724 (MAVS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD_2
Motif
Other DBs
NCBI-GeneID: 102443724
NCBI-ProteinID: XP_006139293
LinkDB All DBs
Position
Unknown
AA seq 890 aa AA seqDB search
MGFAEDKVYEYIRQNMSDFQGIRVLELLRYLPCLTDADREKIQAEADRQGNESGMWQIFF
HLKCRSCWVKEFIEALRKNKHEDLADRVHSEYRAHQVRPRNNAPLPAVNNSLPSHSSPPI
VNPNSWHAGSTSENNAHTSPSPRQPSSLPELHQSSPSGVEGYKGLAARAVPVTSMEQLAR
QKVTEDALTLRPEAPRRQPTGNAALADLRTSQEGSNHGDGQACLSPGSPGSDQLAREGSL
RGVVVGAEPGMPVSDPIGQGQDWASRQQHPVCVSGGYFGNMNHLNVGSSRKASVPGEPVQ
RGESAATPRPEDFRNQPEEVYYSSFERSPVASSANRAVHGEGQEAADSLRQQKIQALQGY
EHGNLLSPVVDVGDPFLLQIQFDIEQKQAQRQREQGGEREAFPLPQIRDSAQSTRSYGEG
GALKGRAGFSPDVGPAPAAQMPSTIPPDLSEDSSARETGALRLGTTRSASSSAKLASGSS
AGASQGTPEQNPGSGSNSHRGRESAGCLAESPEGASGPANSREPRSKVQIPAPAADVLRP
ASTPGPSNVLPISSSPHARSAEEFSEHSSFSSTAVIPPSSPVLPPDLSEPAFSSDPGKLK
SPVQESEQPAGGTDSRTAVPKENANRTPTPPAPSVTRPNPELPGSTRRETRNALPGSPRG
CQVFCEPAEEVEFSKPGVLLSTRDEEAPAARQPDAAETNEQYSGRSDRFCFSSLGNNPLL
ISKSSTASARQARSNQPEENHYSSRSDPFLPAWAARNGPGSDGATKTCRASLSPESCSSS
WNSTTVKTHEVHVEENPGVDLGEAAGLHDGDGAYENPSSASSGSHGKLSRYQEGNRNNPP
AAPGLSPQKINKPSPGGGGAAFPWKDYALPAAIAAFACVVAFLFYKHLRN
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggggtttgccgaggacaaggtttacgaatacatacggcaaaatatgtccgacttccaa
ggcatccgagtgctggaactgcttcgttatctgccgtgtctcactgatgcagacagggaa
aagatccaagccgaggccgacaggcaaggcaacgagtccggcatgtggcagatcttcttc
cacctgaaatgcaggagctgctgggtgaaggagttcattgaggcgctccggaagaacaag
cacgaggatcttgcagacagagttcatagcgagtacagagctcaccaagtccgtcccagg
aacaacgcgccgcttcctgcggtgaataactctctgcccagccactcctcaccacccatt
gtgaatcccaattcctggcatgctggctccacttctgagaacaatgcccacacctctcca
tcacccaggcagccatcaagtctcccagagcttcatcagtcaagtccctccggagtggaa
ggctacaaagggctggcggcccgtgctgttccggtgacaagcatggagcagttggcaagg
caaaaggttacagaagatgccctgaccctgaggccggaagctccacgtcgccagcccact
gggaatgcagcactagctgatctcaggacttcccaggaaggcagtaaccatggagatggc
caggcctgtttgtctcctgggtccccggggagcgaccagctggcccgtgaggggtcgctc
agaggagtagtggtaggggctgagccaggtatgcccgtttccgacccaatcggacagggg
caggactgggcgagccgccagcagcacccagtctgtgtgagtggtgggtactttgggaac
atgaaccacctgaatgttgggagcagcagaaaggcctccgtgcctggagagcctgttcag
agaggggagtcggctgccacgccgaggccagaggatttcaggaaccagccggaagaggtt
tactattcttcttttgagcgctcccccgtggcttccagtgccaacagagctgtccatgga
gaggggcaggaggctgcagattcgctccggcaacagaagattcaggcgttgcagggttat
gagcatgggaacctgctgagtcccgtggtggatgttggtgaccctttcctcctgcagatc
cagtttgacatagagcagaaacaggcccagaggcagagagagcagggtggagagagggaa
gcgtttcccctcccccagatcagagattctgcccagagcacgcgcagttacggggagggg
ggagccctcaaaggcagggctggtttcagccctgatgttggaccagcgcctgctgctcag
atgccaagcaccatccccccggatctcagcgaagattcgtcggctcgtgaaacgggagca
ttacgtctcggcacaactcgctcggccagctcctctgcaaaactggcttccggctcttct
gctggagcttcccaggggacccctgaacagaacccaggcagcggcagcaattcccaccgg
ggtagggagtcagctgggtgcctggcagagagcccagaaggtgccagtggcccagcaaac
agcagggagcctcgaagcaaagtccagatcccggcgcctgcagctgacgtgctacgcccg
gcttcgacgcctgggcccagcaacgttcttccaatcagttcctccccccacgccaggtct
gcggaggaattctcagagcatagcagcttctcttccactgctgtgattccgcccagttcg
cctgtattgccccctgacctatccgagccagcgttcagcagcgacccggggaagctgaaa
tctcccgtccaagagagtgaacagccagcgggaggcacggacagccgcaccgccgtgcca
aaggagaacgcaaatcgaacgcccacgccccctgctccaagtgtgacccgacccaatccg
gagctccctgggagcacaaggcgggagacccgcaatgccttgcccggctccccacggggc
tgccaggtgttctgcgagccggctgaggaggtggagttcagcaagccgggcgtgctactg
tctaccagggatgaggaggcgcccgctgcgaggcagccagacgcagcggagacaaatgaa
caatattctggcaggtccgatcgcttctgcttcagctctctgggtaacaatcccctcctg
ataagcaaatccagcacagccagcgcccgtcaagcacggagcaaccagcctgaggagaat
cactactcctctcgctctgaccccttcctcccagcttgggctgctcgcaatggcccggga
agtgatggggctaccaaaacctgccgggcctccctttccccagagagctgcagcagttcc
tggaacagcaccactgtgaaaactcacgaagtccacgtggaagagaatcctggcgtggat
ctgggggaggccgccggcctgcatgatggagacggggcctatgagaacccatcttcagcc
agctctggctcccacgggaagctctccagataccaggaaggcaatcgcaacaacccacca
gccgctccgggactttcccctcagaagattaacaagcccagcccaggcgggggcggggca
gcctttccctggaaggactacgctctgccagctgccattgctgcctttgcctgtgtcgtg
gctttcctgttctataagcatctgcggaattag

DBGET integrated database retrieval system