KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443770Help
Entry
102443770         CDS       T02980                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss03030  DNA replication
pss03410  Base excision repair
pss03420  Nucleotide excision repair
pss03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102443770 (LIG1)
   03410 Base excision repair
    102443770 (LIG1)
   03420 Nucleotide excision repair
    102443770 (LIG1)
   03430 Mismatch repair
    102443770 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pss03032]
    102443770 (LIG1)
   03400 DNA repair and recombination proteins [BR:pss03400]
    102443770 (LIG1)
Enzymes [BR:pss01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102443770 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102443770 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102443770 (LIG1)
DNA replication proteins [BR:pss03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102443770 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102443770 (LIG1)
DNA repair and recombination proteins [BR:pss03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102443770 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     102443770 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     102443770 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 102443770
NCBI-ProteinID: XP_006133053
Ensembl: ENSPSIG00000011945
UniProt: K7FZW6
LinkDB All DBs
Position
Unknown
AA seq 954 aa AA seqDB search
MMQRPITSFFQPMKGTKAEKETEKIRLPAEEDSTDQVSEAATVQRNGLSLHVDSPVKSAK
RPLRRFLESDSDEEVVMEEAQAEKEPKQDKSPKKTSNKQEHVQTPQSDLSMDSPSPSSSH
SAGDSPALSDSPAVGNADIPKRRTARKQIPKRKMELTISRENNSHEEPTAKRWREQQGPG
DEAGRGAKKEKDVEMQEVKDQHSEMEMAEDNGTLKEVAVNKGEDRGEGGIQKQPEPPQTT
RAISSFFAPKKAPVEKEGKEDKHAAVEPPSVPTSSTTASSDGNDGRAGSFSKLAVPVDPM
EYNPSKSSYNPFQDACWGHGQRVPYLAVARTFERIEEVSARLKNIETLSNLFRSVIALSP
SDILPCIYLCLNRLGPAYKGLELGIGETILMKAVAQATGRQLDQIKAEAQEKGDLGLVAE
SSRSNQRTMFTPPKLSAAGVFSKLQEIARMTGSASMNKKIDIIKGLFVACRHSEARYITR
SLGGKLRIGLAEQSVLSAIAHAVSLTPPGQAFPPEVLDAGQGKSAEARKAWLEEQTQTLK
QTFCELPNYDIIVPVLLEHGVQSLPQHCKITPGIPLKPMLAQPTKGIGEVLKRFEEAAFT
CEYKYDGERAQIHILENGDVHIYSRNQEDNTSKYPDIISRIPKVKKGNVRSCILDAEAVA
WDAEKRQIQPFQVLTTRKRKDVEAAEIKVQVCLYAFDMLYLNGESLVKEPFSKRRQLLHE
SFVEMEGEFLFATSMDTCSMDEISEFLDQSIKDSCEGLMVKTLDVDATYEIAKRSHKWLK
LKKDYLEGVGDTLDLVVIGAYLGKGKRAGMYGGFLLACYDEETEEYQSICKLGTGFTEES
LEKHYSFLKDHVLEKPRPYYRWDSSIEPNHWLAAVQVWEVKCADLSISPVHKAAIGLVDE
EKGISLRFPRFLRVRDDKKPEEATTSSQVAELYKLQQQIQNQQSVEKTEDEDFY
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcgccccatcacgtcatttttccagcccatgaaagggacaaaggctgaaaag
gagacggagaagatcagactaccagcagaggaggactcaaccgaccaagtatcagaggca
gccacagtgcagagaaatggcctgagcctccatgtggactccccagtgaaatctgccaag
aggcccctgcgccgattcttggagagtgacagtgatgaggaagtggtcatggaggaagct
caagcagagaaggagcccaagcaggacaaaagccccaagaaaaccagcaataagcaggag
catgtgcaaactcctcagtctgatctctccatggatagtccctcgccaagcagcagccac
tcggctggagatagcccagcactttctgactcccctgctgttggcaatgctgacatcccc
aaacgcagaacagctcgcaaacagatccccaaacgcaaaatggagctgacaatcagtaga
gagaacaacagccatgaggagccaactgccaagagatggcgagagcaacaaggtccagga
gatgaggcaggcaggggagcaaagaaagagaaagatgtggaaatgcaagaggtgaaagat
cagcattctgagatggaaatggctgaagataatggcactttgaaagaggtggctgtgaac
aagggagaagacagaggtgaagggggaatccagaagcagcccgaaccaccccagaccacc
agagccatctccagcttctttgcccccaagaaggcgccagtggaaaaggaaggaaaggaa
gataaacatgcagcagtggagccaccatctgtcccaactagctcaacgacagcaagcagt
gatgggaatgatggcagagctggcagtttctccaagctagctgtgccagtggaccccatg
gagtacaatccttcgaagagcagctacaatccattccaggatgcctgctgggggcatggt
cagagggtcccctacctggctgtggctcggacctttgagcggatcgaggaggtttctgcc
cgactgaagaacattgagaccctgagcaacctcttccgctcagtgatcgccctgtcgccg
tccgacatcctgccctgcatctacctctgtcttaaccgcctgggccctgcctacaagggt
ctggagctgggcattggcgagaccatcctcatgaaggctgttgcacaggcaacaggccgc
cagctggatcagatcaaagccgaggcccaggaaaagggggatctgggcttggtagcggag
agcagccgtagcaaccaacgcaccatgttcacgccgcccaagctgagtgctgccggggtc
ttcagcaagctacaggagattgccaggatgacaggaagtgcttcaatgaacaagaagatt
gacatcatcaaagggctgtttgtggcctgccggcactcggaagctcgctacatcactcgg
tccctgggtgggaagcttaggattgggctggcggagcagtcagtgctgtcagccattgcc
catgctgtgtctctcactcccccaggacaagcatttcccccagaggtgctggatgctggc
cagggcaaatctgcagaggcacgcaaagcctggctggaggagcagactcagaccctcaaa
cagactttctgtgagctgcctaactatgacatcatagtgcctgtcctgctggagcatgga
gtgcagagcctgccacagcactgcaagatcaccccagggatcccgctgaaacccatgctg
gcccagcccaccaagggtattggggaggtgctgaagcgatttgaggaggctgccttcacc
tgcgagtacaagtatgatggagagcgagcccagatccacatcctggagaatggagatgtg
cacatctacagccgcaaccaggaggacaatacctccaaatacccggacatcatcagccgc
atccccaaggtgaagaagggcaatgtgcggtcatgtatcctggacgctgaggctgtggcc
tgggatgctgagaagaggcagattcaacccttccaggtccttaccacacggaagcgaaag
gacgtggaagctgctgagatcaaagtacaggtgtgtctgtacgcctttgacatgctgtac
ctcaatggagagtccctggtgaaggagccgttctccaagcgccgtcagctgctgcatgag
tcttttgtggagatggagggggagttcttatttgccacctccatggacacatgcagcatg
gatgagatctctgaatttcttgaccagtccatcaaggactcctgcgagggcctcatggtc
aagacgctggatgtggatgccacttacgagattgccaaaagatcccacaaatggctgaag
ctgaagaaggattacctggaaggtgttggtgacacactggacttggtagtgattggtgcc
tatctgggcaagggcaagcgagcaggcatgtatggtggctttctgctggcgtgctatgac
gaggagactgaggagtaccagagcatctgtaagcttgggactggtttcacagaggagagc
ctggagaaacattacagctttctgaaggaccatgtgctggagaaaccacggccctattac
cgctgggacagcagcattgagcccaaccattggctggcagcagtgcaggtgtgggaagtg
aagtgtgctgacctgtccatctcacctgtgcacaaggcagccataggcctggtggatgag
gagaagggcatctccctgcgctttccccggttcctgcgtgtgcgtgatgacaagaagcct
gaggaagccaccaccagctcccaggtggctgaactctacaaactgcagcagcagattcag
aaccaacagtcagtggagaagactgaggatgaggacttctactag

DBGET integrated database retrieval system