KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102443828Help
Entry
102443828         CDS       T02980                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pss01002]
    102443828 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102443828 (ACE)
   04090 CD molecules [BR:pss04090]
    102443828 (ACE)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102443828 (ACE)
Peptidases [BR:pss01002]
 Metallo Peptidases
  Family M2
   102443828 (ACE)
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102443828 (ACE)
CD molecules [BR:pss04090]
 Proteins
  102443828 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32 SfLAP TMEM51
Motif
Other DBs
NCBI-GeneID: 102443828
NCBI-ProteinID: XP_025041734
Ensembl: ENSPSIG00000004735
LinkDB All DBs
Position
Unknown
AA seq 1279 aa AA seqDB search
MCLYCAGHLGATVKNMLDDDDEEEDAKTPLPFSALRRERGLAKPGGSTGKSHSPGRVGKP
LAGDCCVSCWQQWDSVGALGLQLSRILASLEEQNFTEAWGKKAKELYGSIWKNFTDTQLK
KIIGSIQTLGPSNLPLDKRQQYNTILSEMDNIYSTAKVCPPNQTASCWALDPEITDIMAT
SRSYQKLLYAWEGWHSAAGNPLRPKYKAFVALSNEAYRMDGFKDTGAYWRSWYDSPTFED
DLEQLYHQLEPLYLNLHAFVRRKLYERYGPKFINLQGPIPAHLLGNMWAQQWNNIYDMMV
PFPDKPNLDVTSTMVQQNWNATHMFRVSEEFFTSLGLMPMPPEFWEKSMLEKPSDGREVV
CHASAWDFYNRKDFRILQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVSFRSGANPGFHE
AIGDGLRLQRLNHVTQDTESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSSLTPPSRYN
YDWWYLRTKYQGICPPIARNETNFDPGAKFHIPGNTPYIRYFVSFILQFQFHKALCEAAN
HTGPLHTCDIYMSKEAGAKLREVLQAGSSKPWQEILFNLTGTEKMDAGALLEYFSPVTEW
LQSENRKTNETLGWPDFEWRPPVPEGYPDGIDKIADEAQARDFLAEYNSTAEAVWNAYTE
ASWVYNTNITDHNKQIMLEKNLEMSAHTLKHGVQARQFDYSDFQDQSVKRILKKLSDIER
AALPEEELKEYNNLLSDMETTYSVAKVCKGQDKCYSLDPGELYYDELLFSWKGWRDASGK
KIRSKFKRYVELSNKAARLNGHTDNGAFWRSLYETATFEADLERIYQQLQPLYLNLHAYV
RRALHNKYGPEHVNLKGPIPAHLLGNMWAQSWSNIFDLVMPFPSASKVDATPAMQKQNWN
ATHMFRVSEEFFTSLGLMPMPPEFWARSMLEKPSDGREVVCHASAWDFYNRKDFRIKQCT
VVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVSTPKHLHSIN
LLDQVEDNSESDINYLLSIALDKIAFLPFGYLMDQWRWKVFDGRIKEEEYNQQWWNLRLK
YQGLCPPVPRSEDDFDPGAKFHIPANVPYVRFSVSFVIQFQFHQALCKAAGHTGPLHKCD
IYQSKEAGALLGNAMKLGFSKPWPEARQHITGQPNMSADALMTYFKPLTDWLAAENTKTG
ESLGWPEYNWTPYAGQAPSSASARASFLGMSLDSSQAVAGQWVLLFLGVLLLLVSIVLGV
KFHSSRRRAHKSSSEMELK
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttgtactgtgccggtcacttaggcgctaccgtaaaaaacatgcttgatgatgac
gatgaggaagaggatgccaagactccgcttccattcagcgctctgagaagggaaaggggg
ttagccaagcctggaggatccacaggaaaaagccactcccccggccgggtggggaagcct
ctggctggggactgttgcgtctcttgctggcagcagtgggattccgtgggagccctgggt
ttgcagctctccaggatcttggcctccctggaggagcagaacttcacggaggcctggggg
aagaaagccaaggaactctatggctccatctggaagaatttcacagacactcagctgaag
aagatcattggctccatccagaccctggggccttccaacctgcccctggacaagcggcag
cagtacaacaccatcctgagcgagatggacaacatctattccactgccaaggtgtgtcct
cccaaccagaccgccagctgctgggctctggatccagagataaccgacatcatggccacc
tcccgcagctaccaaaagctgctctacgcctgggagggctggcacagcgccgccgggaac
cccctgaggcccaagtacaaggcgtttgtggcgctgagcaacgaggcctacaggatggac
ggtttcaaggacaccggcgcttactggcgctcctggtacgactcgcccactttcgaggac
gatctggagcagctgtaccaccagctggagcccctctacctgaacctgcacgccttcgtc
cggaggaagctgtatgaacgctacggccccaagttcatcaacctccagggccccatccct
gctcacttactgggcaacatgtgggcccagcagtggaacaacatctacgacatgatggtc
cccttcccggacaagcccaacctggatgtcaccagcaccatggtgcagcaaaactggaac
gccacgcacatgttccgggtctccgaggagttcttcacctcgctgggcctgatgcccatg
ccgcccgagttctgggagaagtccatgctggagaagccgtcggacgggcgggaggtggtg
tgccacgcctccgcctgggacttctacaaccgcaaggacttcaggatcttgcagtgcacc
acggtcaccatggagcagctcttcacggtgcaccacgagatggggcacgtcgagtactac
ctgcagtacaaggaccagccggtctccttccgcagcggggccaaccccggcttccacgag
gccatcggcgacggcctgaggcttcagcgcctcaaccacgtgacccaggacacagagagt
gacatcaactacctgctgaaaatggccctggagaagatcgccttcctccccttcggttac
ctcatcgaccagtggcgctggaatgtcttcagcagcctcacccctcccagccgctacaac
tacgactggtggtatctgagaacaaaatatcagggcatctgtcctcccattgcaaggaac
gaaaccaacttcgaccctggtgcaaagtttcacatccctggcaacaccccctacatcagg
tactttgtgagctttatcctgcagttccagttccacaaggccctgtgcgaagccgccaac
cacaccggccccctgcacacctgcgacatctacatgtccaaagaagccggagccaaactc
agggaggtgctgcaagccggctcttccaagccatggcaagaaatcctcttcaatttgact
ggcacggagaagatggacgctggggccctcctggagtacttcagccccgtgaccgaatgg
cttcagagtgagaaccgcaaaaccaatgagactctgggctggccggacttcgagtggcgc
ccgcctgtccccgagggctaccccgacggcatcgataaaatagccgatgaagcacaagcc
agagacttcttggcagagtacaacagcacagctgaagcggtgtggaatgcctacactgag
gcgtcctgggtgtacaacaccaacatcaccgaccacaacaagcagatcatgctggagaag
aacctggagatgtcggcccacaccctgaagcatggcgtgcaggcccggcagttcgactac
tctgacttccaggaccagagcgtcaagcgcatcctgaagaaactgagcgacattgagaga
gccgccctgccggaggaggagctgaaggagtacaacaacctcctctcggacatggagacc
acgtacagcgtagccaaggtctgcaaggggcaggacaaatgctactccctggatccaggt
gagctgtactacgacgagctcctcttctcctggaagggctggcgggacgcctccgggaag
aaaatccggagcaaattcaagagatacgtggagctgagcaacaaggcagccagactcaat
ggccacacggacaacggggccttctggagatccctctacgagacggccaccttcgaagca
gacctggagaggatctaccagcagctgcagcccctgtacctcaacctgcacgcctacgtg
cgccgcgccctccacaacaagtacggcccggagcacgtcaacctgaagggccccatcccg
gcccacctgctcggcaacatgtgggcccagtcctggtccaacatttttgacctggtgatg
cccttcccttctgcctctaaagtggatgccaccccagccatgcagaaacagaactggaac
gccacgcacatgttccgggtctccgaggagttcttcacctcgctgggcctgatgcccatg
ccgcccgagttctgggccaggtccatgctggagaagccgtcggacgggcgggaggtggtg
tgccacgcctccgcctgggacttctacaaccgcaaggacttcaggatcaagcagtgcacg
gtggtgaacatggacgacctgatcacggtgcaccacgagatgggccacgtgcagtacttc
ctgcagtacaaggaccagcccatctccttccgcgacggggccaaccccggcttccacgag
gccatcggcgacgtcatggccctgtcggtctccacccccaagcacctgcacagcatcaac
ctgctggaccaggtggaggacaacagcgagagtgacattaactacctgctgagcatcgcc
ctggacaagatcgcctttctgcccttcgggtacctgatggaccagtggcgctggaaggtg
tttgacgggcgcattaaggaggaggaatataaccagcagtggtggaacctcaggctgaag
taccaaggcctgtgcccgcccgtgcccaggtcggaagacgactttgatcctggggcgaag
tttcacatcccagccaacgttccctatgtcaggttctctgtcagttttgtgatccagttc
cagttccatcaggccctctgcaaagcggccggccacaccgggcccctgcacaagtgtgac
atctaccagtccaaggaagccggagccctgctggggaacgccatgaagctgggcttcagc
aagccctggccggaggccaggcagcacatcaccgggcagcccaacatgtcggccgacgcc
ctgatgacctacttcaagccgctgacggactggctggctgctgagaacaccaagaccggg
gagagcctgggctggcccgagtacaactggacgccctatgcgggtcaagcgccgtctagt
gccagtgccagagccagtttcctggggatgtcgctggatagcagccaagccgtcgcaggc
cagtgggtcctgctgttcctcggcgttctcctgctccttgtctcgatcgtcctcggagtc
aaattccactcctccaggagaagggctcacaaatccagctcagaaatggaactgaaataa

DBGET integrated database retrieval system