KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444025
Entry
102444025         CDS       T02980                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102444025 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102444025 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pss04052]
    102444025 (KITLG)
Cytokines and growth factors [BR:pss04052]
 Growth factors
  Growth factors (RTK binding)
   102444025 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102444025
NCBI-ProteinID: XP_014424479
Ensembl: ENSPSIG00000009365
UniProt: K7FR23
LinkDB
Position
Unknown
AA seq 278 aa
MKKTQTWIITCFYLQLLLLNPLAKAQGPCGNPVTDDVNDITKLVGNLPNDYMITLRYVQK
METLPNHCWLHLMVPEFLRSLHNLLQKFSDMSDVLSNYSIINNLTRIINDIILCLDSEKN
KNFIKENGHLYEEGRFIPEEFFRRFNSTIEVYKDFAKASDHSDCVLPSTTKTPENNPRVT
VTKPFLLPPVAASSLRNDSSDSKKEMLNFPSSLSLNGISIALASLFSLLIGFTLGAICWK
KTHRTPRPESDETTQCNNCQEDNEISMLQQKEKELLQV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcttttatcttcagctgctcctacttaat
cctcttgcaaaagcccaaggtccctgtgggaatccagtgacagatgatgtgaatgacatt
acaaaactggttggaaatcttccaaatgattatatgataacccttaggtatgttcagaag
atggaaactttgcctaatcactgttggctgcatttgatggtgcctgagtttttaaggagt
ctgcataatcttctgcaaaaattttcagatatgtctgatgttttaagcaactattcaatc
atcaataatctaacaaggataatcaatgatattatattatgtcttgattctgaaaaaaat
aagaatttcataaaagaaaatggtcatctttatgaagaaggcaggttcattcctgaagaa
ttctttaggcgctttaatagcaccattgaagtctacaaggattttgcaaaagcatcagat
catagtgactgtgttctgccatcaacaacaaaaacaccagagaacaatccaagagtcact
gttacaaagccatttttgttacctcctgttgctgccagctcccttaggaatgacagcagt
gacagtaagaaagagatgctcaacttccctagcagcctcagcctgaatgggataagcata
gcattggcgtcattgttttctcttcttattggctttactttgggagccatctgttggaag
aaaacacatcgcacacccaggccagaaagtgatgaaacaacacagtgtaataactgtcaa
gaggataatgaaataagtatgttgcagcaaaaagaaaaagagctcctacaagtgtag

DBGET integrated database retrieval system