KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444350Help
Entry
102444350         CDS       T02980                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00310  Lysine degradation
pss00514  Other types of O-glycan biosynthesis
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102444350
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102444350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pss01003]
    102444350
Enzymes [BR:pss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     102444350
Glycosyltransferases [BR:pss01003]
 O-Glycan biosynthesis
  O-linked Gal type
   102444350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25
Motif
Other DBs
NCBI-GeneID: 102444350
NCBI-ProteinID: XP_014436124
Ensembl: ENSPSIG00000003163
UniProt: K7F5I6
LinkDB All DBs
Position
Unknown
AA seq 86 aa AA seqDB search
MNLMYDLEEEGLDWDLIYIGRKRMQVEHPEKSVPHVRNLVEADYSYWTLAYVISLQGAQK
LLAAEPLSKMLPVDEFLPVMFDKHPV
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgatgtatgacctggaagaagaaggtctggattgggacctgatttacattgga
aggaaacgaatgcaggtggagcatccagagaagtctgtgcctcatgtgcggaatctggtg
gaggcagattattcctactggactctagcctatgtgatttcactacagggtgcccagaag
ctgctggcagctgagccactctccaagatgttgcctgtggatgaattccttccggtcatg
tttgataaacaccctgtgtga

DBGET integrated database retrieval system