KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444760Help
Entry
102444760         CDS       T02980                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102444760 (CACNA1E)
   04020 Calcium signaling pathway
    102444760 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pss04040]
    102444760 (CACNA1E)
Ion channels [BR:pss04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102444760 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel Lustrin_cystein
Motif
Other DBs
NCBI-GeneID: 102444760
NCBI-ProteinID: XP_014430924
Ensembl: ENSPSIG00000008742
LinkDB All DBs
Position
Unknown
AA seq 2445 aa AA seqDB search
MLGLSACSLSAHTLPEASAFVANGAGQLDADSRRYVLALPEEETWRKPPRGVTQATQSGG
LLEPEASGEALVSRTASSDTLYEPPSREGEAGLGMEGSGAFELGLSQYIPVSPDVIKRRR
GGLIEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVAGRLGAGEGGSEQNRIRQGAPA
PPGASPAAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEDNMVRKYAKKLIDWPP
FEYMILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVF
HKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIV
LKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYTNNSGELEELDPPHPCGV
QGCPSGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLY
FIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKA
EEVMLAEENKNAGTSALEVLRRATIKRNRTEAMNRDSSDEHCVDISSVGTPLARGSIRSA
KVDGASYFRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPPWLTHILYY
AEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNFFDCGVTVGSIFEVVWAIFRPGTSFGISV
LRALRLLRIFKVTKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFN
FMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIILTLFG
NYTLVNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPALERDR
RRRHHMSMWEPRSSQLRDRRRRHHMSVWEQRTSQLRRHMQMSSQEGLNKDAPPLINPHAS
IFRRKKPGENAGEKSEEDQGGRAEQPPGEGLEQPTADTNACPSAKEDQKTPSPRAKRDRE
QWHQKSCHGNCDGTEPEGAGRGGGAGMEDRARLRQSQRRSRHRRMRTEGKEAAGALESRS
ASQEVGLEEVNPTDGEQARKEGEKADVIQEEPLAGEEQDRTSDIPAGDAAFAGAMKETSP
LRAPQELSPEKNESLAEQDCSGLDTSDQALLGSVQLEMSRAVSRSEPELSSVTAHTEKAT
ESTTIMIDVQDSAVVQISNKTDGEASPLKEAEAKEVEAKEKKRKKEKSSRSGKAMVPHSS
MFIFSTTNPVWRAVHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYV
FTGVFTFEMIIKMIDQGLILRDGSYFRDLWNILDFIVVVGALVAFALANTLGTNKGRDIK
TIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFK
GKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVSTGE
GWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDK
MMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNT
VVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIG
SITEIILTDTKLVNTSSFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCL
LIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFLASLMLLFRSATGEAWQEIMLSC
LEGKGCEPDTTATSGQSQNEHCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRD
SSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVL
MNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILAIWPHLSQKMLD
VLVPLPKTTDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPPEIL
SNAKALPFLQQXXXXLTPVAYLSSRSGYPSMSPLSPQEIFQLACMDPTHGQFQEQQSLEP
EVREFQRVQPSNRGNYLPVDTQERAVAGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKR
PNSSWLDEFSMERSSENTYKSRRRSYHASLQLSARRLNADAGHRSETHRAGGRERGRSKE
RKHLLSPDISRCNSEERSPQAEGESPVRRQSRSPSEGRSQTPNRQGTGSLSESSIPSISD
TSTPRRGRRQLPPVPPKPRPLLSYASLMRHSGDTSPQPDESEGGSPLFSQVLEMNDTCLT
ESSSSPPGKQSRHSTPQRYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGS
APPLRHGWQMPNGHYRRRRRGAAAQGVMCGASIDVLSDTEEDDKC
NT seq 7338 nt NT seq  +upstreamnt  +downstreamnt
atgcttggactcagcgcgtgctccctcagtgctcacacgctccccgaggccagcgccttc
gtggccaacggcgccggccagctggatgccgactcccgccgctacgtcctggccctcccc
gaggaagagacgtggcgcaagcccccgcgaggcgtgacgcaagccacccagtccggcggc
ctgctggagcccgaggcctcgggggaggcgctggtctcgcgcacggccagttctgacacc
ctctatgagccaccatcccgggaaggggaggccggcctgggcatggaggggagcggcgct
tttgagctgggcctgagccagtacatcccagtgagcccggacgtgatcaagcgccggcga
ggcgggctgatcgagcagcgggacatcatcaaggcgcacgaggctcacaagatgcagagc
acgccacaggcgaggcggaaggagtgggagatggctcgcttcggggaggcggtggccggc
cgcctgggagccggagaagggggctccgaacagaaccggatccgccagggagcccccgcg
cctcccggagcctccccggcagccttcaagcaaaccaaagcgcagcgggccaggacgatg
gcgctgtacaaccccatcccggtccggcagaactgcttcaccgtcaacagatccctcttc
ctcttcggggaggacaacatggtccggaaatacgccaagaagctcatcgactggccgccc
ttcgaatacatgatcctggccacgatcattgcaaactgcatcgtcctggcgctggagcag
cacctccccgaggatgacaagacgcccatgtcccgacgactagagaagacagagccttac
ttcattgggatcttttgctttgaagcggggattaaaatagttgctctgggatttgttttc
cacaagggctcatacctccggaatggctggaatgtcatggacttcatcgtggtcctcagt
ggcatcctggccacggctggaacgcacttcaacacccatgtggacctgcggaccctgagg
gcggtgcgtgtgctcaggcctctgaagctcgtctcaggcattcccagcttacagatcgtg
ctgaagtccatcatgaaggccatggtgcctcttctgcagataggcctcctgctctttttt
gccattctgatgttcgccatcattggcctggagttctacagtggaaaactgcaccgagct
tgctacaccaacaattcaggtgaactggaagaactggatccccctcatccatgtggggtg
caaggatgcccctcgggttatgagtgcaaggagtggatcggtcccaacgatgggatcacg
cagtttgacaacatcctctttgctgtgttgaccgtcttccagtgcattaccatggaagga
tggaccacagtgctgtacaataccaatgatgccttaggagccacctggaactggctgtac
ttcatccccctcatcatcatcggctccttctttgttcttaaccttgtcctgggagtgctg
tctggggagtttgccaaagagcgagagcgagtggagaaccgcagagccttcatgaagctg
cggcgccagcagcagatcgaacgggaactgaacggctaccgggcgtggatagacaaagca
gaggaagtaatgctggctgaagagaataaaaatgcggggacgtcagccttggaagtgctg
aggagggcaaccatcaaaaggaaccggacagaagccatgaatcgggactcgagcgatgag
cactgcgtcgacatctcctccgtgggtacccctctcgctcggggcagcatccggagcgct
aaggtggatggtgcctcctatttccggcacaaggagcggcttctgcgcatctctgttcgc
catatggtgaagtcccaagtcttttattggattgtcttgagcttggtggctctcaacacg
gcctgcgtggccattgtccatcacaaccagccgccgtggctcacccacatcctctactat
gcagagttcctcttccttggcctcttcctcctggagatgtccttaaagatgtatgggatg
ggaccgcgcctgtactttcattcctctttcaacttctttgactgtggggtcacagtggga
agcatctttgaggtggtctgggctatcttcaggccaggaacctctttcgggatcagcgtc
ttacgagcccttcggcttctgagaatatttaaagtaacaaagtattgggcgtccctgcgg
aatttggtggtctctctgatgagttccatgaagtcgatcatcagcctgctcttcctcctt
ttcctcttcattgtcgtcttcgctctgctgggaatgcagctctttggaggcagatttaat
ttcatggatgggactccttctgcaaacttcgacactttccctgcagccatcatgacagtg
tttcagatcctgacaggcgaggactggaacgaggtgatgtacaacgggattcgctcccag
ggcggcgtccgctcaggcatgtggtcctccatctacttcatcatccttaccttgtttgga
aactataccctggtgaacgtgttcttggccatcgccgtggacaacctagccaacgcgcag
gagctgaccaaggatgagcaggaggaagaggaggcttttaaccaaaagcacgcgctgcag
aaagccaaggaagtcagcccgatgtctgctccaaacatgcctgctcttgaaagggacaga
aggaggagacaccacatgtcgatgtgggagccgcgcagcagccaactgagggacaggagg
cggcgccatcacatgtcggtgtgggagcagcgcaccagtcagctccgcaggcacatgcag
atgtccagccaggaaggcctcaacaaggatgcccctcccctgatcaaccctcacgccagc
atattccggaggaaaaagcccggggaaaacgccggggagaagagtgaagaggaccagggg
ggcagggcagagcagccaccgggggaaggcctggagcaacccaccgcagacaccaacgca
tgcccaagcgccaaagaggaccagaaaacaccctcccctcgggctaagagagacagggag
cagtggcatcagaaatcatgccacgggaactgcgatgggactgagccggagggggcaggc
agagggggcggggcagggatggaggacagagcccggctgcggcagagccagcggcgcagc
cgacaccggcgaatgaggacggaggggaaggaggcggcgggggcgctggagagcaggtca
gccagccaagaggtgggcctggaggaagtcaatcccacggatggagagcaggctagaaag
gaaggggagaaggcggacgtgattcaggaggagccgctggcgggcgaggagcaggacagg
accagtgacatcccggccggggacgctgcctttgctggggccatgaaggaaacgagcccc
ctcagagccccccaggagctcagcccggagaagaacgagagcttggcggagcaggactgc
agcggcctggacaccagtgaccaagccctgctgggcagcgtgcagctggagatgagcaga
gccgtcagccggagcgagcctgagctgtcctcggtcacggcccacacggagaaagccact
gagagcaccaccatcatgatcgatgtccaagactccgctgtggtacagattagcaacaag
acggatggagaagccagccccttaaaggaggcagaggccaaagaggttgaggcaaaggag
aagaaacggaagaaggagaaaagctccaggtcgggcaaagccatggtgcctcacagctcc
atgttcatcttcagcacgacaaaccccgtgtggcgtgccgtccactacatcgtgaacctg
cgctacttcgagatgtgcatcctcctggtgattgccgctagcagcatcgccctggccgca
gaggaccctgtcctgaccaactcggacaggaacaaagtcctgcggtattttgactacgtt
ttcacaggcgtcttcacctttgagatgattatcaagatgatagaccagggcttgatcctg
cgggacggctcctacttccgagacctctggaacatcctggatttcatcgtggtggtcggg
gccctggtggcttttgccttggcgaatacactggggaccaacaaaggtcgggatatcaaa
accattaaatctctccgtgtgctccgggtattgaggcctctgaagaccatcaagcggttg
cccaaactcaaggctgtcttcgactgcgtagtgacctccctgaagaacgtcttcaacata
ctcatcgtctacaagctcttcatgttcatcttcgcggtcatcgcagtccagctcttcaag
ggcaaattcttctactgtacggacagctctaaggacacggagaaggattgcatagggaat
tatgtggaccatgagaaaaacaagatggaggtgaagtgtcgtgaatggaagcgccatgaa
tttcactacgacaacatcatttgggctttgcttacgctcttcactgtctccacgggagag
gggtggccacaggtgctgcagcattcggtggatgtgactgaggaggaccgggggcccagc
cgcagtaaccgcatggagatgtccattttttacgtggtctattttgtggtcttccctttc
ttctttgtcaacatctttgtggccctcatcatcatcacgttccaggagcaaggggacaaa
atgatggaggagtgcagtctggagaagaacgagagggcatgcatcgactttgccattagt
gccaaacctctcacgcgctacatgcctcagaaccggcacaccttccagtaccgcgtctgg
cacttcgtggtctccccgtccttcgagtacaccatcatggccatgatcgcgctcaacacg
gtggtgctgatgatgaagtattattccgcgccctacacgtacgagttggctctgaagtac
ctgaacatcgcatttaccatggtgttctcattggagtgcgtcctgaagatcatagcgttt
ggcttcctgaactatttccgggacacctggaacatctttgacttcatcactgtgattggc
agcatcaccgaaatcatcctgaccgacaccaagctggtgaacaccagcagcttcaacatg
agctttctgaagctgttccgggctgctcgtctcatcaagctgctccgccaaggctacacc
atccgtatccttctgtggacctttgtgcagtctttcaaggctctcccgtatgtttgtctc
ttgatcgctatgcttttcttcatctatgcaatcattgggatgcaggtttttgggaatatc
aaattagatgaagaaagccacattaaccgtcacaacaacttccgcagcttcctggcttcc
ctcatgctcctttttaggagtgctacaggggaggcgtggcaggagatcatgctgtcatgc
ctggagggcaagggctgtgagccagacaccactgcaacgtctgggcagagccagaacgag
cactgtggcacggatctggcttacgtctactttgtctccttcatcttcttctgctccttc
ctgatgctcaatctctttgtggctgtcatcatggacaattttgaatacctgactcgggat
tcctccatcctggggcctcatcacttagacgagtttgtccggatctgggcggagtatgac
agagctgcctgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtca
ccaccgctaggcctcggcaagagatgtccctccaaagtggcctataagaggctggtgctg
atgaatatgcctgtggcggaggacatgacggtccatttcacctccaccttgatggcgctg
atccgaacggcgctggacatcaaaatcgctaagggtggtgcagactggcagcagttggat
tcagagctgcaaaaggagattctggccatctggcctcacctgtctcagaagatgctggat
gtactagtgcccctgccaaaaactaccgacctgacggtgggcaaaatatacgccgccatg
atgatcatggactactataagcagagcaaagcaaagaagcagaggcaacagctggaggaa
cagaaaaacgcgcctatgttccagcgcatggagccttcttccctgcctccagagatcctt
tcgaatgccaaagctttgcctttccttcagcagnnnnnnnnnntcttgacgcctgtcgca
tatctgagcagccggagtgggtacccgtcgatgagtccgctctctcctcaagagatattc
cagctggcttgtatggatccgactcacgggcagttccaggagcagcaatctctggagcca
gaggttagagagtttcaaagagtgcagccctctaaccgtggcaactatctccccgtggac
acgcaggagcgcgctgtagctgggagggcctcctccatgccacgcctgactgtggatccc
caggtggtgacagacaccagctctatgagacgatcgttctccaccatccgggacaagcgt
cccaacagctcctggctggatgagttctccatggagcggagcagcgagaacacctacaag
tcacgccggcgcagttaccacgcctcgctgcagctatctgctcgccgcctcaatgcggac
gcaggccacaggtctgagacgcaccgcgcaggtggcagagagcgggggcgatccaaagag
cgcaagcacttgctgtccccagacatctcccgctgcaactcggaggagcggagtccgcag
gcagagggcgagtctcccgtccggcgccagtcccggtcgcccagcgagggcaggtcgcag
acgcccaacaggcagggcacgggctccctgagcgaaagctccatcccctccatctctgac
accagcaccccgcgacgaggtcgccggcagctcccgcccgtccccccgaagccacgtccg
ctcctctcttacgcctccctgatgcggcactccggggacacctctccgcagcccgacgag
agcgagggggggtcccctctgttctcccaggtgctggagatgaatgacacctgcctgacc
gagtcttccagctctccgccgggcaagcagagccggcactccaccccccagcgctacatc
tcagagccatacctggccctgcacgacgactcccacgcctcggactgcggcgaggaggag
acgctcaccttcgaggccgccgtggccaccagcctgggccgctccaacaccatcgggtca
gccccgcctctgcggcacggctggcagatgcccaacgggcactaccggcggcggaggaga
ggggccgctgcgcagggggtgatgtgtggggccagtatcgacgtgctcagcgacacggaa
gaagatgacaaatgctag

DBGET integrated database retrieval system