KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102444991Help
Entry
102444991         CDS       T02980                                 

Gene name
PIGT
Definition
(RefSeq) LOW QUALITY PROTEIN: GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    102444991 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 102444991
NCBI-ProteinID: XP_006121971
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
FQFRARWDSELHREGVSHYRLFPKALGQLLSKYLVRELHLSLTQGFWRTRTWGQPYLQAP
AGAELWVWFQDTVTDVDKAWKELSNILSGIFCASLNFIDSTNTVTPTASFKPLGLANVTD
HHLLRYAVLPREVVCTENLTPWKKLLPCGSKAGLAVLLKAERLFHTSYHSQAVHIRPICR
DALCLSVSWELRQTLTVVFDLFLCISPPDWSLFKMFSRTITDACPLASESKIYVDISSKT
QANELLEVTPSPLSLHEASVQGDRRTYAVYDLLSPLLFNASRSLNVQLKWKRPQDSSDLS
TPVLYAQRYVSGYGLQTGEICTLVYNTHPYRAFPVILLETVPWYLRLYVHTLVITTKGKE
NKPSYIHYQPAQDRRRPHLLEMLIQLPANSVTKITIQFERALLKWTEYTPDPNHGFYVSP
SVLSALVPSVIAMNAEDAEQSPLFTSLXVDLVSDHGGYFVRLYTEPLLVNLPTPDFSMPY
NVICLTCTVVAVCYGSFYNLLTRTFHVEEPSRDGLAKRLANIIRRVRGVPPL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
ttccagttccgggcccgctgggactcggagctgcaccgggagggagtctctcactacagg
ctcttccccaaggctctgggtcagctcctctccaagtacctggtgcgggaactgcacctg
tccctcacccagggcttctggcgaacgcggacctggggacaaccctacttgcaagctcca
gccggggctgagctctgggtctggttccaggacactgtgaccgatgttgataaagcctgg
aaagaacttagtaatatcctctctgggatattctgtgcctctctgaacttcattgattcc
accaacaccgtcactccaacagcatcattcaaacctctgggtttggctaatgttacagat
caccatctcctgagatatgctgtcttgccccgggaggttgtctgcactgagaacctcaca
ccttggaaaaagctgctgccatgtggttcaaaggctggtcttgcggtgttgctgaaggca
gaacgtttgttccacacaagttaccactcccaggcagtgcatattcgccccatctgcagg
gatgctttgtgtctcagtgtctcctgggagctcagacagacgcttaccgtggtctttgat
ctctttttgtgtatttctcctccagactggtccctttttaagatgttctcgcgcaccatc
actgatgcttgtcctcttgcatctgagagcaaaatctatgttgatatttctagtaagacc
caggcgaatgaactgctggaggtaaccccgtccccactgtctttgcatgaagcatctgtg
caaggagacaggagaacctatgcagtctacgacttactgagcccactgctctttaatgca
tctcgcagcctcaatgtgcagctgaagtggaaacgtccgcaggacagctcggatctgtca
actcctgtgctctatgctcagcgttatgtgagtggatatggcctgcagacaggggaaatc
tgcaccctggtttataacacccacccataccgggctttccctgtgatactactggagacg
gtgccctggtatctgagactctatgttcacactttggttatcaccaccaagggaaaggaa
aacaaaccaagttatatccactaccagccggctcaggaccgaaggcggccccatctgctg
gagatgctgatccagctcccagcaaactctgtcaccaaaatcaccatccagtttgagaga
gccttactgaagtggacagagtatacccctgaccccaaccatggcttttatgttagccca
tctgtcctgagtgccctggtgccaagtgtcatagcaatgaatgcagaagatgcagagcag
agtcctctcttcacctcgctgtgagtggaccttgtctctgaccatgggggntactttgtg
cgtctctacacggagccactactggtgaacttgccaacccctgacttcagcatgccatat
aacgtcatctgcctgacctgcactgtggtggccgtgtgttatggctccttctacaatctg
ctgaccagaacctttcatgtggaagagccaagcagggatggcttagcaaagcgactggcc
aacattatccgcagagtccgaggggttccacccctttga

DBGET integrated database retrieval system