KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445093
Entry
102445093         CDS       T02980                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04210  Apoptosis
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04623  Cytosolic DNA-sensing pathway
pss04625  C-type lectin receptor signaling pathway
pss04920  Adipocytokine signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102445093 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102445093 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102445093 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102445093 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102445093 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102445093 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102445093 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102445093 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102445093 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102445093 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102445093 (IKBKG)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102445093 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 102445093
NCBI-ProteinID: XP_006130123
Ensembl: ENSPSIG00000011723
UniProt: K7FYA9
LinkDB
Position
Unknown
AA seq 585 aa
MNGTRQRRSCEMVQPGGCPGSDCSALGEDSSLGKVAAWQLPPELAGHEALQRFLLENQDL
KEAIRQSNQMLRQRYQEFVGFQAVQREEKDFLLLRFREARDVVQKLNAERAEMKRQLEQA
LQEVEQLKGSQKVSGELPATSPRGSRASGLGHLLSDMQKEIPEPEEADTTTLTQELAEPT
MAPGQETQQLEQHQEASQVQQQVQPSNVGLKQENGVQLERPVELETLQGSGDSRASSSRE
AAELLQRRLKEAEEESTGLKQKLAAVQDEVATLAARAQDAEQQVQALRKQLEQMTEDRAS
VKAQVTSLLGELQESQSRLEACVLEKKDLEGKAQAAAEQGRRLAGEAEALHKQHSVQVDQ
LRMQAQNLEAALRVERQSATEEKRKLAQLQAAYHQLFQEYDSHMKSSLDQEKRSQGMELH
LEELLQQLQQAEEALVAKQELIDKLKEETEQHKTLLETIPVLKAQADIYKADFLAEREAR
EKLHEQREALQEQLEQLRRDYDKLKADTEGATWALMEEMRNRHWGGPPPVPQPAYNMAPG
TFQPGPAAGRRRSIPEEQPDFCCPKCQYQAPDMDTLQIHVMDCIK
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgaacgggacccggcaacggcggagttgtgagatggtgcagccaggcgggtgcccaggc
agtgactgcagtgctcttggtgaggactcatcccttggcaaggtggcggcttggcaacta
ccccccgagctggccgggcatgaggccctgcagcgcttcctgctggaaaaccaggatctg
aaagaggccattcgacagagtaaccagatgctgcggcagcgctaccaggagttcgtgggg
ttccaggctgtgcagcgtgaggagaaagacttcctgttgctccggttccgggaggcccgg
gatgtggtgcagaagctaaatgctgagcgggccgagatgaaacgccagctggagcaggcc
ctccaggaggtggagcagctcaagggaagccagaaggtatcaggagagctccctgccacc
tcgccaaggggcagcagggcttcagggttgggacacctgctctcagacatgcagaaagag
atccctgagccagaggaggcggacacgacgactctgacccaggagctggcagagcccacg
atggcccctggtcaagagacccagcagctggagcaacaccaggaggccagccaagtccag
cagcaggtgcagcccagcaacgtggggctcaagcaggagaatggggtgcagctggagagg
cctgtggagctggaaaccctgcagggcagtggggacagcagagccagtagcagtcgggag
gcagccgagctgttgcagaggcggctgaaggaggcagaggaggagagcacagggctgaag
cagaagctggcagctgtgcaggatgaggtggccacgctggcagccagggcacaggatgca
gaacagcaggtgcaggccctgaggaaacagctggagcagatgacggaggacagggcctcg
gtgaaagcccaggtgacttccctactgggggagctgcaggagagtcagagccggctggag
gcctgtgtactggagaagaaggatctggaggggaaagcccaggctgctgcagagcagggc
cgccggctggctggggaagctgaggcgctgcacaagcagcacagtgtgcaggtagaccag
ttgcgcatgcaggcccagaacctagaggcagcgctgcgagtggagaggcagagcgccaca
gaggagaagcggaagctggcccagctgcaggctgcctatcaccagctcttccaggagtac
gattcccacatgaaatctagcctcgaccaggagaagaggagccagggcatggagcttcac
ctggaggagctattgcagcagctgcagcaggcagaggaggcactggtagccaagcaggag
ctgattgacaagctgaaggaggagacagagcagcacaagaccttgctggagaccatcccg
gtgctgaaggctcaggctgatatctacaaagcggatttcctggcagagcgtgaggcccgg
gagaagctgcacgagcagcgagaggctctgcaggagcagctagaacagctgcggcgggac
tatgacaagctgaaggcagacacggagggagccacctgggctctgatggaagagatgagg
aaccgccattggggggggcccccgcctgtcccacagcctgcttacaacatggctccaggg
actttccagcccgggccggcagcagggcgcaggcgcagcatccctgaggagcagccagat
ttctgctgccccaagtgccagtaccaggccccggatatggacacgctgcagatccatgtg
atggactgtatcaagtga

DBGET integrated database retrieval system