KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445365Help
Entry
102445365         CDS       T02980                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102445365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pss01002]
    102445365
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pss04147]
    102445365
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102445365
Peptidases [BR:pss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102445365
Exosome [BR:pss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102445365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102445365
NCBI-ProteinID: XP_006111905
Ensembl: ENSPSIG00000008505
UniProt: K7FMY7
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MKYILVVAFLGAAVAFPLDDDDDKIVGGYTCSKNSLPYQVSLNAGYHFCGGALINSRWVV
SAAHCYKSSIQVRLGEHNIEVREGTEQFINSVKVIRHEKYNSRLLDNDIMLIKLASEATL
NSYVNTIALPTGCVATGTPCLISGWGNTLSSGTNYPDLLQCLKAPVLSSSQCSNAYPGQI
TGNMICIGYLEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYVSWI
KNTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcctggtagtagcttttctgggagcagctgttgcctttccccttgatgat
gatgatgacaagatagtgggaggctacacctgttcaaagaactcgttgccctaccaggtg
tccctgaatgctggataccatttctgtggaggtgccctcattaacagcagatgggttgtc
tcagctgctcactgctacaaatcctctatacaagtgaggcttggagaacacaacatagaa
gtcagagaaggcaccgaacagttcattaactcagtcaaagtcatccgtcacgagaagtac
aactcccggctcctggacaatgacatcatgctcatcaagctggccagtgaagccaccctc
aactcctacgtcaacacaattgccctgccaaccggctgtgtggccactggcaccccgtgc
ctgatctctggctggggcaacactctcagcagtggcactaactatcctgacctcctgcag
tgcctgaaagctcctgtcctgtcttccagccaatgtagcaatgcctatccaggacaaatc
actggcaacatgatctgtatcggatacctggaagggggcaaagattcctgtcagggagat
tctggtggcccagtagtctgcaatggccagctccaagggattgtctcctggggaattggt
tgtgcacagaaaggctaccctggggtctacactaaagtgtgcaactacgtctcttggatc
aaaaataccatcgctgccaactga

DBGET integrated database retrieval system