KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445557Help
Entry
102445557         CDS       T02980                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102445557 (MAPK6)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102445557 (MAPK6)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102445557 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 102445557
NCBI-ProteinID: XP_006118575
Ensembl: ENSPSIG00000005974
UniProt: K7FEJ0
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPNGSQLMDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQDLLTVIPVYIKNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNFEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
ESCWQYPDHHENKYCDLECNHTCNYKMRSSSFLDNLVWRDSEVNHYYEPKLIIDLSNWKE
QSKEKSDKKGKSKCERNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAGTIQLSLQH
ESTDVDKLNDFNSSVSQLELKGLISKSVSREKQEKGMANLAQLEALYQTSWDSQFVSGGE
ECFLIDQFCCEVRKDEHIEKENTYTSYLDKFFSKKEDTEMLETEPVEDGKLGEKEREESF
LSNSGEFFFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHLN
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagtttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttgaaaccactgggctgtggtggaaatggcttagttttttctgctgtcgacaat
gactgtgataaaagagtggctgtcaagaaaattgtcctcacagatcctcagagtgttaaa
catgctctacgtgagattaaaattattagaagacttgaccatgataacattgtgaaagta
tttgaaattcttggtcccaatggaagccagttaatggatgatgtgggctcccttacggaa
ctgaactgtgtttacattgttcaagagtacatggagacagatctggctaacctgttagag
cagggccctttactggaagaacacgccaggcttttcatgtaccagctgctacgtgggctc
aagtatattcactctgcaaacgttctgcacagggatctcaagccagctaatcttttcatt
aatactgaagacttggtgctgaagattggcgactttggtcttgcacggatcatggatcct
cattattcccataagggtcatctttctgagggattggttactaaatggtacagatcaccc
cgtcttttactttctcctaacaattacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcacatgaacttgaacaa
atgcagctgattttagaatcaattcctgttgtgcatgaggaggaccgtcaggatcttctc
actgtaatcccagtttacattaaaaatgatatgactgagccacacaaacctttaacacag
ctgcttccaggcatcagtcctgaagcactggacttcctagagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttatcccatccttatatgagcatttactcc
tttccaacggacgagcccatttcaagccatccttttcacattgaagatgaggttgatgac
attctgctcatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagatcatgactggcctattcataataactttgaagctgatgaagttcagcgt
gatccaagagctctttctgatgtcactgatgaggaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtatctggaagatcctgcttttgacacgcacttctca
gaatcttgctggcaataccctgatcaccatgaaaataagtactgtgatcttgaatgtaat
cacacttgtaactataaaatgaggtcatcttcattcctagataacttagtttggcgagat
agtgaagttaaccattactatgagcccaagcttattatagatctttctaactggaaggag
cagagcaaagagaagtctgataagaaaggcaagtcaaaatgtgaaaggaatggactagtg
aaagctcagatagctcttgaggaagcatcacagcagcttgttgaaaaagaaagggagaag
aatcaggggtttgactttgattcatttatagcaggaacaattcaacttagtttacaacat
gagtctactgatgttgataaattaaatgacttcaatagttcagtgtcccaactggaattg
aaagggttaatatcaaagtcagtaagcagagagaaacaggaaaaaggaatggccaacttg
gcacagttggaagcgctgtaccaaacctcttgggatagccagtttgtaagtggtggggag
gagtgcttcctcatagaccagttttgttgtgaagtcaggaaagatgaacacattgagaaa
gaaaatacttacaccagttacttggacaaattctttagtaagaaggaagatacagaaatg
ctagaaactgagccagtagaagatggaaagcttggggagaaggaaagagaagagagcttt
cttagtaatagtggggagtttttctttaacaagcagttagaggcaataggaattcctcag
tttcacagtcctgttggttcaccacttaaatcaattcaggccacgttaacgccttctgct
atgaaatcgtctccccaaattccccataaaacatacagcagcattctgaaacatctaaat
taa

DBGET integrated database retrieval system