KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445585
Entry
102445585         CDS       T02980                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102445585 (TGFA)
   04012 ErbB signaling pathway
    102445585 (TGFA)
SSDB
Motif
Pfam: EGF Trp_oprn_chp TMEM154 DUF1180
Other DBs
NCBI-GeneID: 102445585
NCBI-ProteinID: XP_006129155
LinkDB
Position
Unknown
AA seq 159 aa
MVSSAGEVAVVALGILLAVCHALENTTSALSGPPVAAAVRSHFNDCPDSHSQFCFHGTCR
FLVQEEKPACVCHSGFVGTRCEHADLLAVVAANQKKQTITALVVVSVVASVVLIVACVLI
HCCRIRKHCEWCRAFICRHEKPSGLLKGGASCCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcagctccgccggggaggtcgcagtggtcgctctgggtattttactagctgtgtgc
catgccctggagaacacaacatctgccttgagcggtcccccagtggctgccgctgtcaga
tcccacttcaacgactgtcccgactcccacagccagttctgcttccacgggacctgcagg
tttctcgtgcaagaggagaagccggcatgcgtctgccattctgggttcgtcgggacgcgg
tgcgaacacgcagacctccttgcggtggtagctgccaatcagaagaaacaaacaatcact
gccttagtggtggtttccgtggtggcatcagtcgtccttattgtggcctgtgtgctaata
cactgctgtaggataagaaaacactgtgagtggtgccgagccttcatctgcagacacgag
aagcctagcgggctcctgaaggggggagcttcctgctgccattcagagacagtggtctga

DBGET integrated database retrieval system