KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445790Help
Entry
102445790         CDS       T02980                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00020  Citrate cycle (TCA cycle)
pss00190  Oxidative phosphorylation
pss01100  Metabolic pathways
pss01200  Carbon metabolism
Module
pss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pss_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pss_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102445790 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102445790 (SDHB)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102445790 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 102445790
NCBI-ProteinID: XP_025036496
LinkDB All DBs
Position
Unknown
AA seq 295 aa AA seqDB search
MVPRSPGTRQLDEQNCPVFHASLQPAFLQACRGAQTAAAAAPASQAVAPRIKTFAIYRWD
PDKPGDKPHMQTYELDLNKCGPMVLDALIKIKNKAHSQTHHSPSGAGRTPGICGSCAMNI
NGGNTLACTKRIDTNLSKVSKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKRDELNQ
GKEQYLQSIEDREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDD
YTEERLAQLEDPFSLYRCHTIMNCTKTCPKGLNPAKAIAEIKKMMATYKEKAVSA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtcccaagaagcccagggacaagacagctcgacgagcaaaactgccccgtgttccat
gcatctctccagccagcatttctgcaggcctgccgtggagcacagacagcagctgcagca
gcacccgcttctcaagcagtagcaccacggatcaagacgtttgcgatctacagatgggat
ccagacaagcctggggataagccacacatgcagacctatgaacttgacctgaataagtgt
gggcctatggtacttgatgcactgatcaagatcaaaaataaagcacattcacaaacacat
cactcaccctctggtgctggccgaaccccaggcatttgtggctcctgtgctatgaacatc
aatggtgggaacaccctggcctgtaccaaaagaattgacaccaaccttagcaaggtctct
aagatctaccctctcccccacatgtatgtggtgaaggatctcgttccggacttgagtaac
ttctatgctcagtataaatccatcgagccttacctgaagaagagggatgaattgaatcag
ggcaaagagcagtatctgcagtccatagaggatcgtgaaaaactggacgggctctatgag
tgcatcctgtgtgcctgctgtagtaccagctgccccagttactggtggaatggagacaaa
tacctgggccctgcagtgcttatgcaggcatatcgctggatgattgactccagagatgac
tacacagaagaacgtctggcacaacttgaggatccattttccctctaccgctgtcatact
atcatgaactgcacgaagacttgccccaagggattgaaccctgcaaaagcaattgccgaa
atcaagaaaatgatggcaacttacaaagagaaggcagtcagcgcataa

DBGET integrated database retrieval system