KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445881Help
Entry
102445881         CDS       T02980                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X8
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04012  ErbB signaling pathway
pss04020  Calcium signaling pathway
pss04114  Oocyte meiosis
pss04217  Necroptosis
pss04261  Adrenergic signaling in cardiomyocytes
pss04310  Wnt signaling pathway
pss04912  GnRH signaling pathway
pss04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102445881 (CAMK2D)
   04310 Wnt signaling pathway
    102445881 (CAMK2D)
   04020 Calcium signaling pathway
    102445881 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102445881 (CAMK2D)
   04217 Necroptosis
    102445881 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102445881 (CAMK2D)
   04916 Melanogenesis
    102445881 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102445881 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102445881 (CAMK2D)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102445881 (CAMK2D)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   102445881 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_4 SnoaL_2 DUF4915
Motif
Other DBs
NCBI-GeneID: 102445881
NCBI-ProteinID: XP_006119303
Ensembl: ENSPSIG00000013669
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MMASTATCTRFTDEYQLFEELGKGAFSVVRRCVKIPAGQEYAAKIINTKKLSARDHQKLE
REARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQ
ILESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGEQQAWFGFAGTPG
YLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWD
TVTPEAKDLINKMLTINPAKRIIASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRK
LKGAILTTMLATRNFSAAKSLLKKPDGVKINNKTNVVTSPKENIPTPALEPQTTVIHNPD
GNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEAL
GNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPK
TMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcaaccgctacctgcaccaggttcaccgacgagtaccagctcttcgaggag
cttggaaagggggcattctcagttgtaagaagatgtgtgaaaattcctgcaggacaagag
tatgctgccaaaattatcaacaccaaaaagctgtctgctagagatcatcagaaattggaa
agggaagctaggatctgtcgccttttgaagcatcctaatattgttcgacttcatgacagc
atatcagaagaaggattccattacctagtctttgatttagttactggaggtgaactgttt
gaagatatagttgcaagggaatactacagtgaagcagatgctagtcattgtatacagcag
attctagaaagtgttaatcattgtcacctaaatggcatagttcacagagacctgaagcct
gagaacttacttttagctagcaaatccaagggagcagctgtaaaattggcagactttgga
ttggctatagaagtccaaggagaacaacaggcttggtttggttttgctggtacaccaggg
tatctttcaccagaggtcttaagaaaagatccctatgggaagccagtggacatgtgggca
tgtggtgtcattctctatattctccttgtgggataccctcctttctgggatgaagaccag
cacagactctatcagcaaatcaaggctggtgcttatgattttccctcaccagagtgggat
actgtgacacctgaagccaaagatctcatcaataaaatgcttaccatcaaccctgccaaa
cgtatcatagcatcagaggcactgaagcatccatggatctgtcaacgttctactgtggcc
tctatgatgcacaggcaggagaccgtagattgcttgaagaaattcaatgcaagaagaaaa
ctaaagggtgccattttaacaactatgctggctaccagaaatttctcagcagcaaagagt
ttactgaaaaaacctgatggagtcaagataaacaacaaaaccaacgtggtaaccagcccc
aaagaaaatattcctaccccggcgctggagccccaaactacagtaatccacaatcctgat
ggaaataaggagtcaacagaaagttccaatacaactattgaagatgaagatgtgaaagct
cgtaagcaggagatcatcaaggttacagagcagctgattgaagctatcaacaatggggac
tttgaagcttacacgaagatctgtgatccaggtcttacatcttttgaacctgaagctttg
gggaatctggtggaagggatggactttcacaggttctactttgaaaatgctttgtccaag
agtaataagccaatccataccattatcctcaatccccacgtccatcttgtgggtgatgat
gctgcctgcattgcctacatacggctgacgcagtatatggatggaagtggaatgccaaag
actatgcaatctgaggagacccgggtctggcaccgccgtgatggcaaatggcagaatgtc
cattttcaccgttcagggtcaccaacagttccgatcaactaa

DBGET integrated database retrieval system