KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102445904Help
Entry
102445904         CDS       T02980                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102445904 (SOD1)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102445904 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102445904
NCBI-ProteinID: XP_006126122
Ensembl: ENSPSIG00000014318
UniProt: K7G779
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MAAVKAVCVLQGEGAGKGVINFEQQGTGPVSLSGTIEGLTEGKHGFHVHEFGDNTNGCTS
AGAHFNPHGKKHGGPQDQERHVGDLGNVTANKDGVAKVSITDSLISLNGPQSIIGRTMVV
HEKDDDLGKGGNEESSKTGNAGARLACGVIGIAKI
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgaaggccgtgtgcgtgctgcagggggagggcgcggggaagggcgtcatc
aacttcgagcagcagggtactggaccggtatcactctcaggaactattgaaggtttgact
gaaggaaaacatggcttccatgtccatgaatttggagacaacacaaatggatgtaccagt
gcaggtgctcacttcaatcctcatggcaaaaaacatggtggaccacaagatcaagagagg
catgttggagatcttggcaatgtgactgctaataaagatggtgtcgcaaaagtgtctatt
acggattctttaatttctcttaatggaccacagtctattattggacgcactatggtggtc
catgagaaagatgacgacttgggtaaagggggaaatgaggagagctcaaaaactggcaat
gctggtgctcgtctggcttgtggtgttattggaatagctaagatctaa

DBGET integrated database retrieval system