KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446242Help
Entry
102446242         CDS       T02980                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102446242
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102446242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N DUF4958
Motif
Other DBs
NCBI-GeneID: 102446242
NCBI-ProteinID: XP_006111130
Ensembl: ENSPSIG00000015562
LinkDB All DBs
Position
Un
AA seq 693 aa AA seqDB search
MAGLQLIKIDWQKEANRRKHHTNEYDSTDLIVRREQPFSITATCNRALKSGESFKFTAET
GPKPSLKAKTQAVFSISSTASNGTWSAVQQSTESSSVTISIYCPANAAIGRYKLSVQPTS
GGNASQGIVGTFVLLYNPWSQGDDVFMPNNAERQEYVMEEFGMVFTGNANRINSSGWNYG
QFQEGILDICLASLDKSLNYRRDPATDVSRRNDPKYVGRVLSAMVNSNDDNGVLEGNWSG
DYRGGTSPSSWNGSVEILKKWNAAGFKPVKYGQCWVFASVLTTVLRCLGIPTRMISNFNS
AHDADKNLSVDEYYDESGNPLRMGGDSVWNFHVWNESWFTRKDLGSSYNGWQILDATPQE
RSAGVFQCGPASLTAIKEGDVDLDYDAPFIFAEVNADRITWSYNTSTTEKKRIYSYTKSI
GHSISTKAVGSYDRVDVTNDYKYEEGSEKEREVYQKAVGKLHVGRGFAGRSMKHEEIVPN
PEISGKFEVDGAFKVGKDVKLTLLLSNLTSEAKNIKVNMTAWTTVYTRKPIHEVWKDSVS
ATLASKEEKRFPIKIAYAEYQQHLTSDNMLRVIALCQEENGIEVVVERNIVLENPELLIQ
VVGDAKVNEPVNVEVIFTNPLDQEVKDCTLQAEGSDLLKGKLKIEMPPLKPKQSSKVPFE
IFPTKTGTKQLLVNFSSDKFTGVKAFETINVAN
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctggtctacaattaatcaagatcgactggcagaaagaagcaaatcggcgcaaacac
cataccaacgaatacgacagcacagacctcattgtgaggagagaacagcccttctccatc
acagcgacctgcaacagagcactgaagtctggagagagcttcaagttcactgcagagaca
gggccaaaaccatcactgaaagctaagacccaggctgtattcagcatctccagcacagca
agcaatggtacctggagcgcagtccaacaatccaccgagtccagctccgtcaccatctct
atttactgtccagccaatgctgccatcggacgctacaaactgagcgtgcagcctacctca
gggggaaatgcctcccaggggatcgtcggaacttttgttctactctataacccctggtct
caaggagatgatgtgtttatgcctaacaatgctgaacgccaagagtacgtgatggaagag
tttgggatggtttttacaggcaacgcaaaccgcattaacagttctggttggaactatggc
cagtttcaagaaggcattctggatatttgcctcgcctcgctggataaaagcctaaactac
cgtagagaccctgccaccgatgtgtctcgcagaaatgatcccaagtacgtgggccgtgtg
ctcagtgccatggtaaacagtaatgatgataatggggtgctggagggaaactggagtgga
gattaccgtggcggaacaagtcccagcagctggaacggaagcgttgaaatcctgaaaaag
tggaacgctgcgggatttaaacctgtcaaatacggacaatgctgggtttttgcatcagtg
ctgaccacagtgctcagatgtctggggattcctactcgtatgatttcaaatttcaactct
gcccatgatgccgataaaaacctgagtgtggatgaatattatgatgaatctggaaatcct
ctgagaatgggaggtgacagcgtctggaatttccatgtctggaatgaaagctggtttacc
cgaaaggacctcggatcctcctacaacggatggcaaattctggatgcgaccccccaggag
agaagcgcaggggtattccagtgtggtcctgcctcacttacggccatcaaagaaggagat
gtagacctggactatgacgctccatttatatttgctgaggtgaatgcagaccggatcacc
tggtcgtacaacaccagtactacagaaaaaaaacgcatctattcctacaccaagtcaatt
ggccattccatcagcaccaaggcagtaggcagttacgaccgtgtagatgtcactaatgat
tacaaatatgaagaaggctctgagaaggaaagagaggtgtatcaaaaggctgtcggaaag
ctgcatgtaggacgtggttttgctggcagatccatgaagcatgaagagattgttccaaat
cctgaaatctctgggaagttcgaggtggatggagccttcaaggttggcaaagatgtcaaa
ctaaccttgcttctcagtaatttgacctctgaggctaagaatataaaggtaaatatgact
gcttggaccactgtgtacaccaggaagccaattcatgaggtgtggaaggactccgtatca
gctactcttgcttctaaagaagagaaacggtttcccattaagatagcgtatgccgagtac
cagcaacatttaactagcgacaacatgctgcgagtgattgctctgtgtcaagaagaaaat
gggattgaagtggtggtggaaaggaacattgttctggagaaccctgagcttctcatacag
gtggtcggtgatgccaaggtgaatgaaccagtgaatgtggaagtgatatttaccaatcct
ctcgaccaagaggtgaaagactgcaccctgcaggcagaaggcagcgacctgctgaaagga
aagctcaagatagaaatgcccccactaaagcccaagcagagctccaaagtgccgtttgag
atctttcccaccaagactggaaccaagcagctgctcgttaatttctccagtgacaagttt
acgggtgtcaaagcctttgagaccataaatgtggccaactga

DBGET integrated database retrieval system