KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446244Help
Entry
102446244         CDS       T02980                                 

Definition
(RefSeq) caspase-8 isoform X1
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04115  p53 signaling pathway
pss04210  Apoptosis
pss04217  Necroptosis
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102446244
   04217 Necroptosis
    102446244
   04115 p53 signaling pathway
    102446244
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102446244
   04621 NOD-like receptor signaling pathway
    102446244
   04622 RIG-I-like receptor signaling pathway
    102446244
   04625 C-type lectin receptor signaling pathway
    102446244
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102446244
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102446244
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102446244
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102446244
Peptidases and inhibitors [BR:pss01002]
 Cysteine peptidases
  Family C14: caspase family
   102446244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED Serpin Dynamin_N
Motif
Other DBs
NCBI-GeneID: 102446244
NCBI-ProteinID: XP_006133700
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MDFHRLLFNISEALTTEDLVALKFLSLEYIPLRKQENIQDSEALFLALEERGMMEKDDLS
FLKELLFRINRIDVLTDKLHSSREEMERELQIPGRAKVSPFRYLLFQLSENITTDELKSW
KFLLKKELPKCKMDNEITMIDVLIEMEKKGLLAEENLKTLKTICEKIDKSLLKKIEEYEL
VQSVEMYVVEGHGGQRVSEGGDSLWVSQTARDSPGTQEEIQQTDMYKMNSQPRGICLILN
NHDFSKARSEVPKLQQMKDRNGTNADAAALTKVFTKLHFEIKEHRDLTAADIRHITHMYR
NKDHRAHDCFVCCILSHGDKGIVFGTDGQEIPIQELTTSFTGTNCPSLAGKPKVFFIQAC
QGDTFQRGIHIETDSTETDYSVEADARFQLECIPNEADFLLGMATMKDFVSYRSTTQGTW
YIQSLCEHLEKSCPRGEDILSILTAVNQEVSRKNDRLNQGKQMPQPSFTLRKKLIFPIN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggacttccacagactcctcttcaacatcagtgaagctctgaccacagaagatctggtg
gctctgaagtttctaagcctggaatacatcccactgcggaagcaggaaaacatccaggat
tctgaagccttattcctagcacttgaggaaaggggaatgatggagaaagacgacctgtcc
ttcttaaaggaactgctgttcaggataaaccgcatagatgtcctgactgataaactgcac
tccagcagagaggagatggagagggagcttcaaattccagggagggcaaaggtgtctccg
ttcagatacctgcttttccagctctcagaaaacataacaacagatgagttgaaatcttgg
aagtttcttctgaagaaagagcttccaaagtgcaagatggacaatgagataacaatgatc
gatgttttaattgagatggagaagaagggactgttggcagaagaaaacctaaagaccctt
aagactatttgtgagaaaattgacaaaagcctcctgaagaaaattgaagaatatgaatta
gtgcaaagtgtagaaatgtacgttgtggaaggacatggaggtcaaagagtctctgaaggc
ggggacagcctttgggtttctcagactgcacgggattctccaggcacccaggaagaaatc
cagcagactgacatgtacaaaatgaacagccagccccgtggaatctgcctgatcctcaac
aatcatgacttttcaaaagcaagatcagaggtgcctaaacttcaacaaatgaaagaccgg
aacggaacaaacgctgatgcagcagctctgacaaaggtcttcaccaaacttcactttgag
ataaaagagcacagagacctcactgcagcagatatccgtcacatcacgcacatgtacagg
aacaaggatcaccgtgcccacgactgctttgtttgctgcatcctttcccatggtgataaa
ggcatcgtatttggtactgatgggcaggaaatacctatccaggaactaaccacttctttc
actggcacgaactgcccatcacttgctggaaaaccaaaagtattcttcattcaggcctgc
caaggtgacacattccagagagggatacatatagaaaccgattctacagagacggattat
tctgtagaggcagatgcaagatttcaactggagtgcattccaaatgaggcagactttctg
cttggaatggccaccatgaaggattttgtttcctacagaagcacaacccaaggcacgtgg
tatatacagtcactgtgtgaacacctcgagaagagttgtccacgaggagaggatattctc
tctatcctgacagcagtgaaccaggaggttagcagaaagaatgacaggctgaaccaaggg
aagcagatgccacaacccagtttcacactcaggaaaaaactcatcttccccatcaactga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447455Help
Entry
102447455         CDS       T02980                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04115  p53 signaling pathway
pss04210  Apoptosis
pss04217  Necroptosis
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102447455
   04217 Necroptosis
    102447455
   04115 p53 signaling pathway
    102447455
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102447455
   04621 NOD-like receptor signaling pathway
    102447455
   04622 RIG-I-like receptor signaling pathway
    102447455
   04625 C-type lectin receptor signaling pathway
    102447455
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102447455
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102447455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pss01002]
    102447455
Enzymes [BR:pss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102447455
Peptidases and inhibitors [BR:pss01002]
 Cysteine peptidases
  Family C14: caspase family
   102447455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED L27_2
Motif
Other DBs
NCBI-GeneID: 102447455
NCBI-ProteinID: XP_025045689
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MNTDIYRLLFSISEALDLENLMALKFLSLEHIPQKSQEDIQNAKDFFLNLQKGGLIKEDD
LSFLKELLFRVNRIDLLAEKLDCNRDEMEKELQNPDKAKVSPYRQLLYQISEEITSEEKK
LQDNAVRVLDCGGSLRRAGWDPLAELPLKSILKLFTEMEKAGIMNETKLTLLKSILQEVR
PDLAQKMNTYELTTQGHMHQKVPCLQTGPFLGPGEWGAKEPMSVPKPENSYRMDNRPHGY
CVILNNAVFKNPDETRMGTDKDAAALKRVFERLQFETIEHQNLEAKEIREKIQDYSNMDH
SNMDCFICCLLSHGEKGKVHGTDWNSVSITDLVSCFTGSKCFSLAGKPKLFLIQACQGRT
GQKNIPVEEDSSRELETDAFPMSSIPDWADILISMATVEDFVCYRYRETGSVYIQCLCEE
LESFCPQRVDLLTILTEVNKKVGEKVFLDKKQMPEIKSTLRKQLIFQVPTPDKKRQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatatatacaggcttctcttctccatcagcgaggctttggacttggaaaac
ctgatggccctgaagtttctgagtctggagcacatcccacagaagagtcaggaagacatt
cagaatgccaaggatttcttcctaaatctccagaagggaggactgataaaagaagatgat
ctgtctttcttgaaggagctgctgttcagagtgaaccgcatagacctcttggctgaaaaa
ctggactgcaacagagatgaaatggagaaggagcttcaaaatccagacaaggcaaaagtt
tctccatataggcaactactttaccagatctcagaagaaataaccagtgaagaaaagaag
cttcaggacaatgctgtaagagtacttgattgtggtggttctttgcgcagagctggttgg
gaccctctggctgagctaccgcttaagtcaatactgaagctctttacagaaatggaaaaa
gctgggataatgaatgaaaccaaactgacactgctgaagagtattttacaggaagtgaga
cctgacctggcacaaaaaatgaatacctatgaattaacaacacagggtcatatgcatcag
aaagtcccttgcctgcaaacagggccatttctgggtccaggtgaatggggagcaaaggaa
ccaatgtccgtgcccaagcctgagaactcctacaggatggacaatcgtcctcatggctat
tgtgtgatactgaacaacgctgtatttaaaaatcctgatgaaaccaggatgggcacagac
aaagatgctgcggctctgaaacgggtctttgagaggcttcagtttgagacaattgagcac
caaaacctagaagcaaaggaaatccgcgagaaaatccaagactatagcaacatggatcat
agcaacatggactgtttcatttgctgcttgctctcacacggtgaaaaaggaaaagtacat
gggacagactggaattctgtatccatcacagatctcgtctcctgcttcacgggatccaag
tgcttctctctcgctggcaaacccaaactcttcttgattcaagcctgccaaggcaggaca
gggcagaaaaatatcccagtggaagaagattcttctcgagagctggagacagatgctttc
cccatgtcttccattcccgactgggctgatatcctcattagcatggccacagtggaagac
tttgtgtgctacagatacagagagacaggcagcgtgtacattcagtgtctctgcgaggaa
ttagagtccttctgcccacagcgtgtagatctgttgaccatcctgacagaagtcaataag
aaagtgggagaaaaagtgtttctcgacaaaaagcagatgccagaaataaaatcaaccctg
cggaagcaactgatcttccaggtgccaacgccagacaagaagcgtcagtga

DBGET integrated database retrieval system