KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446580Help
Entry
102446580         CDS       T02980                                 

Gene name
HDAC5
Definition
(RefSeq) histone deacetylase 5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102446580 (HDAC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pss03036]
    102446580 (HDAC5)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102446580 (HDAC5)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102446580 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln TFIIA
Motif
Other DBs
NCBI-GeneID: 102446580
NCBI-ProteinID: XP_006118401
LinkDB All DBs
Position
Unknown
AA seq 1121 aa AA seqDB search
MLLMPRALGLPAMLQTIYESESCFSSDGVSGREQSLELLSRTQIHALPVAAVDVKPVLPA
AMQNCSSSSSSPVELRPDGRGSVPSVDPAVREQQLQQELLVLKQQQQLQKQLLFAEFQKQ
HEHLTRQHEVQLQKHLKQQQEMLAAKRQQELEQQRKGQQQRQEELEKQRLEQQLLILRNK
EKSKESAIASTEVKLKLQEFLLSKSKELAAGGFNHSLPQHPTCWGAHHTSLDQSSPPQTG
SPGTPPSYKLPLLGTYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVI
STFKKRAIEITVSSVCNSAPGSGPSSPNSSSCTIAENGFTGSTPNIHTEQMLPPRRALAM
DGSASQLNLYTSPSLPNISLGLQATVTVTKSHLNASPKLPTQPEAERQAIPPLRQGGALT
GKFMRTSAASSHWPRAVTRHSSASRLTRCSLLSVPLHGQSPLVTGERVSANMRTVSKLPR
HRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQIQLSKIITKAGELPRQPTTHP
EETEEELTEQQEAPLVAGSPESESTQEDLEEEEGCGPERDEGGESGAEEEPIDSPEVVEL
GVAYKQVFPDAQQLRPIQLFPASLSIATLPHQALSRTQSSPASAGMKSPAAEPPVKHLFT
TGVVYDTFMLKHQCMCGNTNIHPEHAGRIQSIWSRLQETGLLNKCERIRGRKATLDEIQT
VHSEHHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLPCGGIGVDSDTVWNEMHSSSAVR
MAVGCLVELAFKVASGELKNGFAVIRPPGHHAEESTAMGFCFFNSVAITARLLQQKLSIG
KILIVDWDIHHGNGTQQAFYTDPSVLYISLHRYDNGNFFPGSGAPEEVGSGIGVGYNVNI
AWTGGVEPPVGDVEYLAAFRTVVMPIANEFSPDVVLVSAGFDAVEGHLSPLGGYSVTAKC
FGHLTKQLMKLAGGRVVLALEGGHDLTAICDASEACVSALLGVELDPLDQALLQQKPNVN
AVTTLEKVIEIQSKHWSSVKRCASVVSCSLREAQEGEAVEAETVSAMALLSVDTEQGSTD
CSPRYGSSSRVTRGISTLTPALASSCVSPQDVSVGCPQLAH
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcatgccgagggcactgggactgcccgcgatgttgcagactatttacgagagt
gaatcgtgtttctcttcagatggagtatccggacgtgagcagtcgttggagctcctgtcg
cggactcagatccatgcccttcccgtggcagcggtagacgtgaagccagtgctgcctgca
gccatgcagaactgcagcagcagcagcagcagcccggtggagctgcggccagacgggcgg
gggagcgtgcccagcgtggacccagcagtgcgggagcagcagctgcagcaggagcttttg
gtcctgaagcagcagcaacagttgcagaagcagctgctttttgctgagttccagaagcag
cacgagcacctgacgcggcagcacgaagtccagctgcagaagcacctcaagcagcagcag
gagatgctggcggcaaagcggcagcaggagctggagcagcagcgcaaggggcagcagcag
cggcaggaggagctggagaagcagcggctggagcagcagcttctcatcctccggaataag
gagaagagcaaagaaagtgcaatcgccagcacagaagtgaagctgaaactccaggagttc
ctcctcagcaagtctaaagagctggcagcaggtggcttcaaccattccctcccgcagcac
cccacatgctggggagcccatcatacctcattggaccagagttcccctccccagacaggc
agcccaggaacaccgccctcctataaactacccctcctcggcacgtacgacagcagagac
gactttccgctccggaaaactgcctcggaacccaacctgaaagtgcgctcgcggttaaag
cagaaagtggctgagcgcaggagcagccccctgctgcggaggaaagacggaaccgtcatc
agcacgttcaaaaagagagctatcgagatcacagtctcctccgtgtgtaacagtgccccc
gggtccggccccagctcccccaacagctccagctgcaccatcgctgagaacggcttcacc
ggctccacccccaacatccacactgagcagatgctccctccacgcagagccctggcaatg
gacgggtccgctagccagctcaacctctacacctccccatccctgcccaacatctccctg
ggactgcaggcaacggtcaccgtcaccaagtcgcacctcaacgcgtccccgaagctcccc
acccagccggaggcggagcgccaggccatcccgccactgcgccaaggtggggccctgacg
ggcaagttcatgaggacctcagcagcctcctcgcactggcctagggcagtcacccggcac
agctccgcatcccgcctcacccgctgctctctcctgtcagtgccgctccatggccagtcc
ccgctggtgacgggcgagcgggtctccgccaacatgaggacggtcagcaagctgccgcgc
caccgcccactgagccgcacccagtcgtccccgctgccccagagcccccaggccctgcag
cagctagtcatgcagcagcagcaccagcagttccttgagaagcagaagcagcagcagatt
cagctcagcaagatcatcaccaaggcgggcgagctgccccgccagcccaccacgcacccc
gaggagacggaggaggagctgacggagcagcaggaggccccgctggtggccggctcgccg
gagagcgagagcacgcaggaggacctggaggaggaggagggctgcgggccggagagggac
gaggggggcgaaagcggggccgaagaggagcccatcgactcgccggaggtggtggagctg
ggtgtggcttacaagcaggtgttcccagatgctcagcagctgcggcccatccagctcttc
ccagcgtctttgagcattgccaccctgcctcaccaagcgctgagccggacccagtcctcg
cctgcctccgcgggcatgaagagccctgcggctgagcccccggtcaaacacctcttcact
actggcgtggtctacgacacttttatgctaaagcaccagtgcatgtgcgggaacactaac
attcacccagagcatgctgggagaatccagagcatctggtcccggctccaggagactggc
ttgctgaacaagtgtgagcggatccggggcaggaaagccacgctggatgaaatccagaca
gtccattcagagcatcacacgttgctgtatggaaccagccccctcaaccggcagaaactc
gacagcaagaagctgctaggtcccatcagccagaagatgtacgcggtcctgccctgcggt
ggcatcggggtggacagtgacaccgtgtggaacgagatgcactcatctagcgccgtccgc
atggccgtgggttgcttggtggagttagccttcaaggtggcctccggggagctcaagaat
ggctttgctgtcatccggccaccgggacaccatgcggaggaatccaccgccatgggcttc
tgcttcttcaactccgtcgccatcacggccagactcctccagcagaagctcagcattggc
aagatcctcattgtggactgggacattcaccatgggaacggcacccaacaggccttctac
accgatcccagcgtgctgtacatctctctgcaccgctacgacaacggcaacttcttcccg
ggcagcggggcccccgaggaggttggcagcgggataggggtgggctacaacgtcaacata
gcctggacgggtggagtggagccccccgtcggagacgtggagtacctggccgcgttcagg
acggtggtgatgccaatagccaacgagttctccccggacgtggttctggtctctgccggc
ttcgatgcagtggagggacacctgtctcccctgggcggctactccgtcacagcaaaatgt
tttggacacctgaccaagcagctgatgaaactggccggcggacgtgtggtgctggctttg
gagggcggtcacgacctgacagctatctgcgacgcctcagaagcctgtgtctctgccctg
cttggtgtggagctggaccccctggatcaagctctcctgcagcaaaagccaaatgtaaat
gcggtgaccacgctggagaaggtcattgaaatccagagcaaacactggagttctgtgaag
cgttgcgcctcggtggtcagctgctccttgcgggaggcgcaggagggcgaggcggtggag
gcagagacagtgagcgccatggcattgctctcggtcgatactgaacaaggaagcacggac
tgcagccccaggtacggctcctcttctcgtgtcacccggggcatatcgaccctcacgcct
gcattagcctcctcctgtgtatccccgcaggacgtgtccgtgggctgccctcagctggct
cactag

DBGET integrated database retrieval system