KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447107
Entry
102447107         CDS       T02980                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04080  Neuroactive ligand-receptor interaction
pss04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102447107
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102447107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pss04030]
    102447107
G protein-coupled receptors [BR:pss04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102447107
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1155 WBP-1
Other DBs
NCBI-GeneID: 102447107
NCBI-ProteinID: XP_006130313
LinkDB
Position
Unknown
AA seq 285 aa
MTRCFDNESVGFFYNNSQKELTSYWRTKDVLVVTLGLTVSVIVLLTNLLVITAIIINRRF
HYPIYYLLGNLAAADLFAGVAYMFLMFHTGPRTAGLSLRTWFIRQSLLDTSLTASVVNLL
AIAVERHQTVFTMQLHSTMSNQRVVILICCIWVTALLLGLIPSYGWHCLCDLSKCSRMAP
LYSRSYLIFWAISNLVIFLIMVVVYSHIFIYVKRKITHMSKHTSFHPRYKETMINLTKTV
VIILSELFPAQCGSSPCLPGSWGRCFEPPSSSSGTPGGWFASGVT
NT seq 858 nt   +upstreamnt  +downstreamnt
atgacccgctgcttcgacaatgagagtgtggggtttttctacaacaacagccagaaggag
ctgacctcctactggaggaccaaggatgtcttggttgttactctgggcctgacagtcagc
gtcatcgtgctcctgaccaacctgctggtcatcaccgccatcatcatcaaccggcgcttc
cactaccccatctactacctgctggggaacctggcggccgcggatctcttcgctggcgtc
gcctacatgttcctcatgttccacacggggccccggacagcagggctctccctccgcacc
tggttcatccggcagagcctgctggacaccagcctgaccgcctccgtggtgaacctgctg
gccatcgctgtggagcggcaccagacagtcttcaccatgcagctgcacagcacaatgtcc
aaccagcgggtggtgattctgatctgctgcatttgggtcaccgccctgctgcttggcctc
atcccatcctatggctggcactgcctgtgtgatctgagcaagtgctcccgcatggcaccc
ctctacagcaggagctacttgatcttctgggccatctccaacctggtcatcttcctcatc
atggtggtggtctactcgcacatcttcatctatgtcaagaggaagataacgcacatgtcc
aaacacaccagcttccacccccgctacaaggagaccatgatcaatctcaccaaaaccgtc
gtcatcattctcagtgagttgtttcccgctcagtgcggctcctccccgtgtctgcctggg
tcttgggggaggtgttttgagccaccctcctcctcctctgggactccagggggatggttt
gcctctggtgtaacttag

DBGET integrated database retrieval system