KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447310Help
Entry
102447310         CDS       T02980                                 

Gene name
TAB3
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 isoform X1
  KO
K12793  TAK1-binding protein 3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04621  NOD-like receptor signaling pathway
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102447310 (TAB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102447310 (TAB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP FliJ
Motif
Other DBs
NCBI-GeneID: 102447310
NCBI-ProteinID: XP_006138142
Ensembl: ENSPSIG00000012851
LinkDB All DBs
Position
Unknown
AA seq 675 aa AA seqDB search
MAQGSQQLDVQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRVLAQESSKYLYMEYHS
PDDSRINRNRLLHINLGIHPHANYHAEGAQLNGGRTLVHSSSDGHIDPQCTAGKQLICLL
QEPHSAPAVVAASPNYNPFFMNDQNRNAATPPPQPSQQPSSMHPGMNTSAMQGPPPPYMH
IPRYSTNPITVTLSQNLPSGQTVPRALQILPQIPSNLYGTPGSIYIRQTSQCSSGRQTPQ
NTQWHSSPQGPVPHYTPRPLPIYPHQQNYQPSQYSPKQPQISQPAYQSPPASQCPSPFGS
PQHQVQPTQLGHQSSHVFMPPSPSTVPSHPYQQASQGYQKQGGHSISYLPYGGPSLSKGS
MNKIEITVEPPQRPGTAMNRSPSPISNQPSQRNQHQLYTATTPPSGSPSRGMSGQPKPPF
NVNPLYITYTQPVGPTGALTQSPQVMVSQPNSTVFKITVGRAPTENLLNLVDQEEHSAAP
EPIQPISVMPGSGGEKGIHKYQRSCSSGSDDYAYTQALLLHQRARMERLAKELKLEKEEL
ERLKTEVNSMEHNLMQRRLRRVSCTTSIPTPEEMTRLRSLNRQLQINVDCTLKEVDLLQS
RGNFDPKAMSNFYDNIEPGPVVPPKPCKKEHHTSSKQTQPRDEDFEGAPWNCDSCTFLNH
PALNRCEQCEMPRYT
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggggagtcagcaacttgatgtgcaggtactccatgaccttcggcaacgtttt
cccgaaatcccagaaggtgtggtgtctcagtgcatgctccagaacaacaacaaccttgaa
gcatgttgtcgagtccttgcacaagagagcagcaaatatttatatatggagtaccatagc
cctgatgacagcagaataaacaggaatcgccttttgcacattaatctgggtattcatccc
catgccaactaccatgcagaaggagctcaacttaatggtggtcgtacactggtacatagc
tcaagtgatggacatattgatcctcagtgcacagcaggtaaacagttgatatgcttactt
caagaaccacactctgctccagctgttgttgcagcttctcctaattacaatccatttttc
atgaatgaccagaatagaaatgcagctactcctcctccgcagccatctcaacagccatct
tccatgcacccaggaatgaatacatctgctatgcaaggccctcctcctccatatatgcac
atacctcggtacagcacaaatcctattactgttacattatcacaaaacctcccatctgga
caaacagtacccagagctttacaaattcttccacagattccaagcaatctttatgggact
cctggttctatatatattagacagacctctcaatgttcttcaggacgacagactcctcag
aatacacagtggcattcatcgccgcaaggcccagtcccacattatactccgcgcccgcta
cctatttatccacatcaacagaactaccagccttcacagtattctcctaaacagccccag
atctctcagccagcttatcaatcaccacctgcttctcaatgtccttctccttttggctct
cctcagcatcaggtacagcctacccagttaggtcatcagagttcacatgtgtttatgccg
cctagtccttcaactgttccttcccacccttatcaacaagcatcccagggttatcaaaaa
cagggtggtcactcaatatcttatctcccttatggtggacctagtttatccaaaggttct
atgaacaagatagaaattacagttgagccaccacaaagacctgggacggcaatgaataga
agtccttcaccgatcagtaatcaaccatctcaacgaaaccagcaccagctgtatacagcc
actactccaccttcaggctctccttcaagaggtatgtcaggtcaaccaaaaccaccattt
aatgttaatccattatatattacttacacacaaccagttggacctacaggtgcattaaca
cagtctccccaggtaatggtatctcagccaaactcaacagtgtttaaaatcacagttggt
cgagctccgactgagaatcttttaaatttagtggaccaagaggagcattctgcagcacca
gaacctattcagcccatttcagtaatgccaggatctggaggagaaaaaggaatccataaa
taccagaggagttgcagttctggatcagatgactatgcttatactcaagccttgctttta
catcagcgagcaaggatggagaggttagcaaaagagctgaagcttgagaaggaggaacta
gaacgactgaaaactgaagttaatagcatggagcacaatcttatgcaaaggcgacttaga
agagtaagctgtacaacttcaatcccaacacctgaagaaatgaccagattgagaagcctg
aatagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcagtct
agaggtaactttgatccgaaagccatgagcaacttttatgataatatagagcctggtcct
gttgtgccaccaaagccatgtaaaaaagagcatcataccagttccaaacagactcagcca
agagatgaagactttgaaggggccccatggaattgtgatagctgcacctttctaaaccac
cccgcactaaaccgctgtgagcagtgtgaaatgccacgttatacgtga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102451479Help
Entry
102451479         CDS       T02980                                 

Gene name
TAB2
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X1
  KO
K04404  TAK1-binding protein 2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102451479 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102451479 (TAB2)
   04621 NOD-like receptor signaling pathway
    102451479 (TAB2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102451479 (TAB2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102451479 (TAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CUE zf-RanBP XhlA
Motif
Other DBs
NCBI-GeneID: 102451479
NCBI-ProteinID: XP_014424987
Ensembl: ENSPSIG00000016192
UniProt: K7GD66
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MAQGSQQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTKYLYGEGDL
GFSDDSGIPGLRNHMTSLNLDLQSQNVYHHGREGSRMNGSRTLAHSISDGHLQGSQHNNE
LFQQEPQTAPAQVPQGFFNTVSTSNPGHLGFHIGSKGKSSPSQQTPRFNPIMVTLAPNIQ
PGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPSGTARQTQQHPGWGCQFNPMHPQQ
VYQPSQSSPWTTLPTSNSLTHTSSQQSSQPNQQGHQTSHVYMPISSPTTPQAPMIHSSGS
SQSAAHSQYNIQNISTGPRKNQIEIKLEPPQRNSSSKLRSSGPRTSTNPSSLNSQTLSRS
QPTVYIAASPPNTDEVITRSQPKVYISANATTGDEQIVRNQPTLFISTNPGVTTTSRNMS
GQVSMGPAFIHHHPPKSRAVGNNTTATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGVVS
PTFEPTNLLNLPDHYTEPEGIQHLTDPVLAHVDRINDARKLSVGSDDAAYTQALLIHQKA
RMERLQHELEIQKKKLDNLKSEVNEMENNLTRRRLKRSNSVSQIPSLEEMQQLRSCNRQL
QIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFLGPMPPKPKDQRSIVKTPKTVPDTD
EDEGAQWNCTACTFLNHPALNRCEQCEMPRHF
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggaagccagcaaatagattttcaggttttacatgacctgcgacaaaaattt
ccagaggtacctgaagttgttgtgtccagatgcatgttacagaataataataacttggat
gcctgttgtgcagttctgtctcaggaaagcacgaagtatctctatggtgaaggagaccta
ggtttttcggatgattctgggattcctggattacgaaatcacatgacatctcttaactta
gatttgcagtcacagaatgtgtatcaccacggaagagaaggaagtagaatgaatggaagt
aggactttagctcacagcattagtgatggacatcttcaaggcagccagcacaacaatgaa
ctgtttcagcaagagccacaaacagcaccagctcaagttccacagggattctttaataca
gttagtacttctaatccaggacacttgggatttcacataggcagcaaaggaaaatctagc
ccctctcagcagacacccagattcaatcccattatggtaactttagcccccaatattcag
cctggtcgcaatacccctacatctttgcacatacatggtgtacctccacctgtacttaat
agtccacagggaaattctatctatattaggccttatattacaactccaagtggtacagct
cgacagacacagcagcatccaggttgggggtgtcagttcaatcccatgcatcctcagcaa
gtctaccagccttcacaatcaagtccctggactactcttcctacatccaattctcttaca
catacctcatcacaacagtcatcacagccaaaccaacaaggccaccagacttctcatgtc
tatatgcctatcagttcacccaccactccacaagcacccatgattcattcatctggtagt
tcacaatctgctgcccacagccaatataacattcaaaatatctcaacaggacctcgcaaa
aaccaaatcgaaatcaaacttgaaccaccacaaagaaacagctcttcaaagctgcgttca
tctggtcctcgcacttccactaatccctcttccctgaacagccagacattaagtagaagt
caacccactgtttacatagctgccagtccaccgaatacagatgaagtgatcacacgcagt
caacctaaggtctacatttcagcaaatgccacaacaggagatgaacagattgtgcgaaac
caaccaacactcttcatatcaacaaatcctggggtaactactacctctaggaatatgtct
ggtcaagtaagcatgggtcctgcatttattcatcaccatccacccaagagtcgagcagtg
ggcaacaacaccactgcaacctctcctcgagtggtagtcacgcagcctaacacaaaatat
acttttaaaattacagtttctccaaataaaccccctgcagtttcaccaggggtagtatcc
ccaacctttgaacctacaaatcttctaaaccttcctgatcactatacagaaccagaggga
atccagcatcttactgaccctgttttagcacatgtggataggatcaatgatgcacggaaa
ttgagtgtgggatctgatgatgctgcctatacacaagctttactgatacaccagaaagcc
aggatggagcgacttcaacatgaacttgagattcaaaagaaaaagttggataatctaaaa
tcagaggtcaatgaaatggagaataatctgacacgaaggcggctgaaaagatcgaattct
gtttctcaaattccttcactggaagaaatgcaacagttgcgaagttgtaacagacagctg
cagatagacatagattgcctaaccaaagagattgatctttttcaagcaagaggaccacat
tttaatcccagcgctattcataacttttatgacaatattggatttctaggtcctatgcca
ccaaaacccaaagatcaaaggtccattgtcaaaacaccaaagactgttccagacacagat
gaagatgagggagctcagtggaattgtactgcttgtacttttttaaatcatccagcctta
aaccgttgtgaacagtgtgaaatgcctcggcatttctaa

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102453103Help
Entry
102453103         CDS       T02980                                 

Gene name
TAB1
Definition
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss05132  Salmonella infection
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102453103 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102453103 (TAB1)
   04621 NOD-like receptor signaling pathway
    102453103 (TAB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102453103 (TAB1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102453103 (TAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C
Motif
Other DBs
NCBI-GeneID: 102453103
NCBI-ProteinID: XP_014429632
Ensembl: ENSPSIG00000011225
UniProt: K7FWY5
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MGTSLFLFTKEQQPSWTDDLPLCQLSGVGSAPNRSYGADGKSTEGHPLEDNWLKFRSENN
CYLYGVFNGYDGNRVTNFVGQRLSAELLLGQLNADHGDADVRRVLLQAFDVVERSFLESI
DDALAEKASLQSQLPEGVPHHQLPSQFQKILERLKALEREISGGAMAIVAVILNNKLYIA
NVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRFSQLGLDAGKIKQVGTICGQESTR
RIGDYKVKYGYTDIELLSAAKSKPIIAEPEIHGGQLLDGVIGFLVLMSEGLYKALEAAHG
PGQANQEIAAMIATEFAKQTLLDAVAQAVVDRVKRIHCDTFASGGERSKFCPRHEDMTLL
VRNFGYPLGEMSQPMLTPTQGGRIYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHS
SSTLDEATPTLTNQSPTMTLQSTNTHTQSSSSSSDGGLFRSRPSHSLQPDEDGRVEPYVD
FAEFYRLWNMDHGEQGLMTVS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggcacttcgctgtttttgttcaccaaggagcagcagccaagctggacagatgatttg
ccactttgccagctctctggagtgggctcagctccaaaccgttcctatggtgcagatggt
aagagtacagaaggccacccattggaggataactggctgaaattcaggagtgagaacaac
tgctacctctatggggtcttcaatggctatgatggtaaccgagtcaccaactttgtgggc
cagaggctctccgcagagctgctgctgggccagctaaatgcagatcacggtgatgctgat
gtgcgccgggtgcttctgcaggctttcgatgtagtagaaagaagtttcctggagtccatt
gatgatgccttggcagagaaggccagtcttcagtcccagctgcctgagggagtaccccac
caccagctgccatcccagttccagaagatcctggagagattgaaggccttagagcgggag
atctctggaggagccatggcaattgtggctgtcatactcaacaacaagctctacatcgcc
aatgtaggtacaaaccgggcactgctgtgcaaatctacggtggacgggttgcaggtgacc
cagttgaatgtggaccatacgacagagaatgaggatgaactcttccgcttctcccagctg
ggtttggatgcagggaaaataaagcaagttggaaccatctgtgggcaagagagcacccgg
cgcattggggattacaaggtgaaatatggctacactgatatcgaactgctcagtgctgct
aaatctaagcccatcatagcagagcctgaaatccatggaggacagctgttggatggagtg
attggcttcctggtactcatgtcagaagggctctacaaagctctggaggcagctcatggg
cccggacaggccaatcaggagattgcagccatgattgccacagagtttgctaagcaaaca
ttgctggatgcagtggcgcaggctgtggtggaccgggttaagcggatccactgtgacacc
tttgctagtggtggggaacgatccaagttttgcccccggcatgaggacatgacgctgctg
gtgaggaactttgggtacccgctgggcgagatgagccagcccatgctgaccccaacacaa
ggaggccgcatctatcctgtctccgtgccatactccagtgcccagagcacaagcaagacc
agtgtaacgctgtcccttgtcatgccttcccaaggccagatggtcaacggtgcccatagc
agctccaccctggatgaagccacgcccacactcactaatcagagcccaacaatgactctc
cagtccaccaacacccatacccagagcagcagctcgagttcagatggaggcctcttccgc
tcccgtccctcccactcgctccagccagatgaggatggacgtgttgagccctatgtggac
tttgcagagttctaccggctttggaacatggaccatggtgagcagggattaatgacagtg
tcctga

DBGET integrated database retrieval system