KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447754Help
Entry
102447754         CDS       T02980                                 

Definition
(RefSeq) 2'-5'-oligoadenylate synthase 1-like
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04621  NOD-like receptor signaling pathway
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102447754
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102447754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 Polbeta SMODS Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 102447754
NCBI-ProteinID: XP_014428718
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MTVAPREYGIFWPPKPSCAKGPIREGPNQRRSQASLQPNKTFKTQINSAIKFIFDVLTQN
CFKGAGSRMRVLKVVKAGSSGKGKALKKMSDVDLVVFVSLVESFQDLRDKRKEIIAEIEA
RLEECGSSLGKNIELEIKETKWKNPRVLTFSLTSTAMGEKMEFDVLPAFDVLGQLGRDYT
RPKPAVYVQLIKSKPKRNEFSSCFTELQRNFVRGLPTKLKSLICLVKHWYKGLTKKLKKG
ESLPPQYALELLSVYAWEKGGRGEGFDMAEGFRTVLELIQQHAQLCVYWTVNYDFKDHIL
ESYLQYQCFKASGNNSSVLHYGHAGAPNDKTIDDGDLWCSGYLCPQLVGGLGRKDPDFKH
LVSGF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggctccacgggaatacgggatattttggcccccaaagcccagctgtgccaag
gggccgatccgggaggggccgaaccagagacgaagccaggccagcctgcagcccaacaaa
actttcaagacccagatcaacagcgccattaaattcatcttcgacgttctgacccaaaac
tgcttcaaaggtgctggctcccggatgcgggtcctgaaggtggttaaggctggctcctcg
gggaagggcaaagcccttaagaaaatgtccgacgtggacctggtcgtgtttgtcagtttg
gtggagagtttccaggacctgagagacaaacggaaggaaatcattgccgaaatcgaggcc
cggctggaggaatgtggatcttccctgggaaaaaacatagagctggaaattaaggaaaca
aaatggaagaacccccgtgtgctcactttctccctcacctccaccgccatgggcgaaaaa
atggagtttgacgtgcttccagctttcgatgtcctaggccagcttggcagagactatacg
cgtcccaagcctgcggtctacgtccagctgattaagagcaagcccaaaagaaacgagttc
tcctcctgcttcaccgagctgcagaggaacttcgtcaggggtctccccaccaaactgaag
agcctcatctgcctggtgaagcactggtacaaaggcctcacaaagaagctgaagaaaggg
gagtccctgcccccgcagtatgccctggagctcctgtctgtctatgcctgggagaaaggg
ggcaggggtgaagggtttgacatggccgagggcttccggacggtgctggagctgatccag
cagcacgcccagctttgcgtctactggaccgtcaactacgactttaaggatcatatcctg
gaatcgtacctgcaatatcagtgcttcaaagccagtggcaacaactcctctgttttgcac
tatggacatgctggagccccaaatgacaagactattgatgatggagacttgtggtgttct
gggtacctgtgtccccagttagtgggtggtttggggaggaaggacccagatttcaaacac
ttagtttcagggttttga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448391Help
Entry
102448391         CDS       T02980                                 

Definition
(RefSeq) 2'-5'-oligoadenylate synthase 3-like
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04621  NOD-like receptor signaling pathway
pss05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102448391
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102448391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Motif
Other DBs
NCBI-GeneID: 102448391
NCBI-ProteinID: XP_006116231
Ensembl: ENSPSIG00000005272
UniProt: K7FCB2
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MAVDLYQTPARKLDKFIFDNLQPDCTFLRQAGQAIDTICEFLKTNCFVDQPAPRTKVLKI
IKGGSLGKGTSLKGISDADLVVFLSCFKGYDDQERNRAEIIREIRRMLEKCQQQKQFDVI
FETSQWSNPRVLSFQLHSKMLNESIDFDVLPAYNALSSSAKPDPQVYEDLIVSYSRGGEF
STCFTELQRDFVVDRYTKVKSLIRLVKHWYKQYVCPHKKYLSKGKEFLPPQYALELLSIY
AWERGSKNRGFDMAKGFRTVLELIQQYKQLCVYWTVNYNFADEELAQFLHRQLQKTRPVI
LDPADPTGIVGEGCRWDLMAMEAEKCCAQQCCVDFYGVPVEPWDVPPVQTHEGSRGFEIH
TGAQEPQVSVPQLEPAYISYQARAFQQPREPAYTSSYTGYQDRAFQQPEEQPSFCTVL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctgtggatctttaccagaccccagctcggaagctggataagtttattttcgacaac
ctgcagcccgactgcaccttcctgcgccaggctggccaagccatcgacaccatctgcgag
ttcctgaagacaaactgcttcgttgaccaacccgcgccccgcactaaggtgctgaagatt
attaagggcggctccttgggcaaaggcacctccctgaaaggcatctccgatgctgacctg
gtggtgttcctcagctgcttcaaggggtacgatgatcaggaaaggaaccgggctgagatc
atcagagagatccggaggatgctggagaagtgccagcaacagaagcaatttgacgtgatc
tttgagacgtcccagtggtcgaacccccgtgtattgagcttccagctgcattccaagatg
ctcaacgaatccatagattttgacgtgctgccagcctacaatgccctgtcctcgagtgcc
aagcctgacccccaggtgtacgaggatctgattgtcagctactcccgggggggcgagttc
tccacctgcttcacggagctgcagcgggattttgtggtggatcgctacactaaagtgaag
agcctgatccgcctggtgaaacactggtacaagcagtacgtgtgtccgcacaaaaagtac
ctgagcaaggggaaggagttcctgcccccccagtacgcgctggagctcctgtccatctat
gcctgggagcgcggaagcaagaatcgaggctttgacatggccaaaggcttccggacggtg
ctggagctgatccagcaatataagcagctctgtgtctattggaccgtcaactacaacttt
gcagacgaggagctggcacagttcctgcaccgtcagctccagaaaaccaggcccgtcatc
ctggacccagcagatccgacggggatcgtgggggaggggtgccgctgggacctgatggca
atggaggctgagaagtgctgtgcccagcaatgctgcgtggacttttacggcgttcccgtg
gagccatgggatgtgccgccggtgcaaacccacgaagggagcaggggctttgagatccac
accggagcacaagaacctcaggtctcagtacctcagcttgagccggcctacattagctac
caagctagagccttccagcagcccagagagccggcctacaccagcagctacacgggttac
caagacagagccttccagcagcccgaagagcagccatccttctgcactgtcctctga

DBGET integrated database retrieval system