KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447815Help
Entry
102447815         CDS       T02980                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04110  Cell cycle
pss04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102447815 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102447815 (HDAC1)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102447815 (HDAC1)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102447815 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102447815 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102447815 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102447815 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RNA_polI_A34
Motif
Other DBs
NCBI-GeneID: 102447815
NCBI-ProteinID: XP_006117612
Ensembl: ENSPSIG00000004134
UniProt: K7F8S5
LinkDB All DBs
Position
Un
AA seq 475 aa AA seqDB search
MALTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLQMEIYRPHKANAEEMTKY
HSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQ
QTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAF
YTTDRVMTASFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVISK
VMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRN
VARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLF
ENLRMLPHAPGVQMQPIPEDAVQEDSGDEDEEDPDKRISMRSADKRIACDEEFSDSEDEG
EGGRKNVANFKKAKRVKTEEEKEEEEKEKKDEKEEEKAKEEKAEPKGVKEETKSA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacacaggggaccaagcggaaagtctgttactactatgacggggatgttgga
aactactattatggccagggtcatccaatgaaaccccataggatccgaatgacccacaac
ctcctgcaaatggagatatatcgcccccacaaggcaaatgcagaagaaatgaccaagtat
catagtgatgactacattaaatttctgagatctattcgccctgataacatgtctgagtac
agcaagcagatgcagagattcaatgttggggaagattgcccagtgtttgatgggctgttt
gagttttgtcagctgtctgcaggaggttctgttgccagcgctgtgaagctgaacaagcaa
cagacagatattgctgtgaattgggcaggaggccttcaccacgctaagaaatcggaggct
tctggcttctgttacgtcaacgacattgtcttggccatcttggagctcctaaagtaccac
cagagggtgctgtatattgacattgatatccatcatggcgatggcgtggaggaagccttt
tacaccacagaccgtgtcatgactgcgtcctttcataagtatggagaatacttcccagga
acaggggatctgcgggatattggtgcaggtaaaggcaagtattatgctgtcaactatcct
ctccgggacggaattgacgatgagtcctacgaggcaatatttaagccggtcatatctaaa
gtgatggagacgttccagcccagtgcagttgccttgcagtgtggatcagattccctgtcg
ggggacaggctggggtgtttcaatctcaccatcaaaggtcatgccaagtgtgtggagttc
gtaaagagtttcaacttgcccatgctgatgctaggagggggtggctacacaatccgcaac
gtggctagatgctggacttacgagactgctgtggctttggacacagaaattccaaatgag
cttccatataatgactattttgaatactttggacccgactttaagctccacatcagccct
tcgaacatgaccaaccagaacaccaatgagtatcttgagaagattaagcaacggctgttt
gagaatctgcgcatgctccctcatgcccctggtgtccagatgcagccgattcctgaggac
gctgtgcaggaggacagtggagatgaagatgaagaggaccctgacaaacgcatttcaatg
cgctctgctgacaagagaatagcctgtgatgaagaattttcggattctgaagatgaaggg
gaaggtggtcgcaaaaatgttgccaattttaagaaggcaaagcgtgtgaaaacggaagag
gagaaggaggaggaggagaaggagaagaaagatgagaaagaagaggaaaaagccaaagag
gagaaagcagaacccaaaggggtaaaggaagagactaaatcggcctaa

DBGET integrated database retrieval system