KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448785Help
Entry
102448785         CDS       T02980                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04068  FoxO signaling pathway
pss04114  Oocyte meiosis
pss04218  Cellular senescence
pss04261  Adrenergic signaling in cardiomyocytes
pss04370  VEGF signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04933  AGE-RAGE signaling pathway in diabetic complications
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102448785 (MAPK14)
   04370 VEGF signaling pathway
    102448785 (MAPK14)
   04068 FoxO signaling pathway
    102448785 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102448785 (MAPK14)
   04218 Cellular senescence
    102448785 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102448785 (MAPK14)
   04621 NOD-like receptor signaling pathway
    102448785 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    102448785 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    102448785 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102448785 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    102448785 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102448785 (MAPK14)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102448785 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102448785 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102448785 (MAPK14)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102448785 (MAPK14)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102448785 (MAPK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 102448785
NCBI-ProteinID: XP_014425312
Ensembl: ENSPSIG00000006647
LinkDB All DBs
Position
Unknown
AA seq 283 aa AA seqDB search
MKHENVIGLLDVFTPAKSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRG
LKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNW
MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGPELLKKISSESARN
YIQSLSYMPKMNFENVFIGANPLAVDLLEKMLVLDTDKRITAAEALAHGYFSQYHDPDDE
PVADPYDQSFESRELEIEEWKSLTYDEVVSFVPPPLDQEEMES
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaatgtgattggtctgttggatgtgttcacacctgctaagtcactggaa
gaattcaatgatgtgtacctcgtgacccacctcatgggggctgatctaaacaacattgtg
aaatgtcagaagctcacagatgaccatgtacagtttcttatataccaaattcttcgggga
ctgaagtacatccattcggctgatataatacacagagacttaaagcctagtaacctagct
gtaaatgaagactgtgagctgaagattctggattttggtttggcccggcacacagatgat
gagatgactggatatgtggctaccaggtggtacagggctcctgagattatgctgaactgg
atgcattacaaccagacagttgatatttggtcagttgggtgcattatggctgagctgttg
actggacgaacattgtttcctggtacagaccatattgatcagttgaagctcattttgaga
ctcgttggaaccccaggtcctgagcttttgaagaaaatctcctcagagtctgcaagaaac
tacatccagtctttgtcctacatgccaaagatgaattttgaaaatgtgtttattggtgcc
aatccactggctgtggacttgctggagaagatgctggtgctggacacagacaagcgaatt
actgcagctgaggcattggcccatggctatttctctcagtaccatgacccagatgacgaa
ccagtggcagacccctatgaccagtcttttgaaagcagagaactcgagattgaggaatgg
aaaagtctgacctatgatgaagtagtcagctttgtgccacccccgcttgaccaagaggag
atggagtcctga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455939Help
Entry
102455939         CDS       T02980                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04068  FoxO signaling pathway
pss04114  Oocyte meiosis
pss04218  Cellular senescence
pss04261  Adrenergic signaling in cardiomyocytes
pss04370  VEGF signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04933  AGE-RAGE signaling pathway in diabetic complications
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102455939 (MAPK13)
   04370 VEGF signaling pathway
    102455939 (MAPK13)
   04068 FoxO signaling pathway
    102455939 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102455939 (MAPK13)
   04218 Cellular senescence
    102455939 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102455939 (MAPK13)
   04621 NOD-like receptor signaling pathway
    102455939 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    102455939 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    102455939 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102455939 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    102455939 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102455939 (MAPK13)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102455939 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102455939 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102455939 (MAPK13)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102455939 (MAPK13)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102455939 (MAPK13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Haspin_kinase FTA2 DUF3754 Hormone_2
Motif
Other DBs
NCBI-GeneID: 102455939
NCBI-ProteinID: XP_006115739
Ensembl: ENSPSIG00000006732
UniProt: K7FHH9
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MSLTWRKGFYRQDVNKTVWELPRRYTSLHPVGSGAYGSVCSAIDKKTGEKVAIKKLCRPF
QSEIFAKRSYRELMLLKHMQHENVIGLLDVFTSATSFSAFQDFYLVMPYMRTDLQKIMGH
EFSDEKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCELKILDFGLARQTDAEMT
GYVVTRWYRAPEVILNWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKITG
LPGEEFVQKLEDKAAKKYIQSLPKIPKMDLSVLFPKANPLAVDLLDKMLQLDVEKRLTAT
DALAHPYFDQFRDIEEETEAQQSYDDSLDHEKLSIDEWRRHTYNEIQAFSPIVRKDSKRR
SGMSL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaacctggcgcaaaggtttttacaggcaagacgtaaacaaaaccgtctgggag
ctgcccagaagatatacttccctccatccagtgggatctggggcgtatggctctgtctgt
tcggccatagataagaagacaggggagaaagtggccatcaagaagctgtgccgaccattc
cagtcagagatctttgccaagagatcgtacagggagctgatgctgctgaagcacatgcaa
catgagaatgtcattggcttgctagatgtcttcacctcggccacctccttctccgcattc
caggacttctacctggtgatgccatacatgcggacagatttacaaaagatcatggggcat
gagttcagtgatgaaaagatccagtacctcgtctaccaaatgctgaaagggttaaagtac
attcattctgctggaatcattcaccgggacctgaagccaggcaatctggctgtgaatgaa
gactgcgaactaaagatcctggactttggcttggcgagacaaacggacgctgagatgact
ggctatgttgtgacgcgctggtacagagccccagaagtcattctgaactggatgcattac
aaccaaactgtggacatctggtctgttggctgcatcatggcagaaatgctgactgggaaa
accttgtttaaaggaaaggactatctagatcagctgacccagatcttgaaaataaccgga
ctcccaggagaggagtttgtgcagaaactggaggacaaagcggctaagaagtatatccag
tcccttcccaagattcccaaaatggatttatctgtgcttttccccaaagccaaccctctg
gctgtggacttgctcgacaagatgctgcagctggacgtggaaaagcgtctcacagccaca
gacgctctggcccacccatacttcgaccaattccgagacattgaggaagaaactgaggcc
cagcagtcctatgacgattccttggatcatgagaagctttccatagatgagtggagacgg
cacacttacaatgagattcaggccttcagtccgattgtccggaaggactccaagaggcgc
agcggtatgtcattgtag

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102462429Help
Entry
102462429         CDS       T02980                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04068  FoxO signaling pathway
pss04114  Oocyte meiosis
pss04218  Cellular senescence
pss04261  Adrenergic signaling in cardiomyocytes
pss04370  VEGF signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04933  AGE-RAGE signaling pathway in diabetic complications
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102462429 (MAPK11)
   04370 VEGF signaling pathway
    102462429 (MAPK11)
   04068 FoxO signaling pathway
    102462429 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102462429 (MAPK11)
   04218 Cellular senescence
    102462429 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102462429 (MAPK11)
   04621 NOD-like receptor signaling pathway
    102462429 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    102462429 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    102462429 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102462429 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    102462429 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102462429 (MAPK11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102462429 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102462429 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102462429 (MAPK11)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102462429 (MAPK11)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102462429 (MAPK11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 102462429
NCBI-ProteinID: XP_006122676
Ensembl: ENSPSIG00000013808
UniProt: K7G5X7
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MSARGGFYKQELNKTVWEVPQRYQNLTPVGSGAYGSVCSAYDTKTRQKVAVKKLSRPFQS
LIHARRTYRELRLLKHMTHENVIGLLDVFTPATSIENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQTDDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PSPELLKKISSEHARKYIESLPYMPQQDLKAVFRGANPLAVDLLEKMLILDSDKRITASE
ALAHAYFVQYHDPDDEPEAELYDESIENKERTIDEWKEITYEEMISFKPPDLKMDSLEIE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgcgaggcggcttctacaagcaggaattgaacaagacggtgtgggaggttccc
cagcgctaccagaacctgaccccggtgggctccggagcctacggctccgtgtgttcagct
tatgataccaaaacaagacagaaggtggcagtaaaaaagctttcaagaccttttcagtca
ctaattcatgcaagaaggacctatcgggagcttaggttgcttaagcacatgacacatgaa
aatgttataggattactagatgtttttacacctgcaacttcaatagaaaattttaatgaa
gtgtatctcgtgacaaatttaatgggtgctgacttgaataacattgtaaagtgccagaag
ctaacagatgaccatatacagtttctcatctaccagttacttagaggacttaagtatatt
cactcagctggaatcatccaccgggacttgaaacccagtaacctagctgtaaatgaagac
tgtgaattaaggattttagactttggcttagctcgacaaactgatgatgaaatgactgga
tatgtagcaacaagatggtacagagctccggaaattatgttaaactggatgcattataat
caaacagttgacatttggtcagtgggatgcatcatggcagagttactgaaaggcaaggct
ctttttccaggaaacgactatattgaccaactaaagagaataatggaagttgtaggaaca
cccagtcctgaacttcttaagaaaatatcatcagaacatgctagaaaatacattgaatct
ctaccatatatgcctcagcaggatttgaaagcagtatttcgtggtgccaacccattagct
gtagatcttcttgagaagatgcttatattagacagtgataaaagaataacagcctcagaa
gcacttgctcatgcttactttgtccagtatcatgatcctgatgatgagcctgaggccgag
ctatatgacgaatcaatagagaataaagaacgaaccatagatgaatggaaagagattaca
tatgaagaaatgattagctttaaaccacctgatttaaaaatggatagcctggaaatagaa
cagtaa

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102462672Help
Entry
102462672         CDS       T02980                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X2
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04010  MAPK signaling pathway
pss04068  FoxO signaling pathway
pss04114  Oocyte meiosis
pss04218  Cellular senescence
pss04261  Adrenergic signaling in cardiomyocytes
pss04370  VEGF signaling pathway
pss04620  Toll-like receptor signaling pathway
pss04621  NOD-like receptor signaling pathway
pss04622  RIG-I-like receptor signaling pathway
pss04625  C-type lectin receptor signaling pathway
pss04912  GnRH signaling pathway
pss04914  Progesterone-mediated oocyte maturation
pss04933  AGE-RAGE signaling pathway in diabetic complications
pss05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102462672 (MAPK12)
   04370 VEGF signaling pathway
    102462672 (MAPK12)
   04068 FoxO signaling pathway
    102462672 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102462672 (MAPK12)
   04218 Cellular senescence
    102462672 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102462672 (MAPK12)
   04621 NOD-like receptor signaling pathway
    102462672 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    102462672 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    102462672 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102462672 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    102462672 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102462672 (MAPK12)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102462672 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102462672 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pss01001]
    102462672 (MAPK12)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102462672 (MAPK12)
Protein kinases [BR:pss01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102462672 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like UvrD_C DUF3381 FTA2
Motif
Other DBs
NCBI-GeneID: 102462672
NCBI-ProteinID: XP_006122677
Ensembl: ENSPSIG00000014289
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MSSAKKGFYRQEITKTLWEVRERYRDLQPVGSGAYGAVCSAIDGRSGIKVAIKKLYRPFQ
SELFAKRAYRELRLLKHMKHENVIGILDVFTPDVTLEKFNDFYLVMPFMGTDLSKIMKHE
KLTEDRIQFLVYQMLKGLKYIHSAGIIHRDLKPGNLAVNEDCELKILDFGLARHTDSEMT
GYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGRPLFKGNDHLDQLTEIMKITG
TPTQDFVQKLQSQDAKNYIKSLPKVQKKDFAAILKYANPLAVNLLEKMLVLDADKRITAV
EALAHPYFEPVHDPEEETEAEKYDDTFDNMDLPLDEWKRITYKEVLNFKPPPLPESKETA
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaagaaaggcttttaccggcaggaaatcacgaaaaccttgtgggaggtg
cgggagcgctaccgggacctgcagccggtgggctccggagcctacggcgctgtgtgctca
gctattgatggaagaagtggcatcaaagtggccatcaagaaattgtaccgtccatttcaa
tctgaactctttgccaaacgagcctatcgggaactacgcctcctgaaacacatgaagcat
gaaaatgttattggaatattggatgtgttcacaccagatgtaacactggagaaatttaat
gatttctacttagtcatgccatttatgggaacagacttgagtaagataatgaagcatgag
aaactaactgaagatcgaatccagtttctggtctaccaaatgttaaagggcctaaagtat
atccattcagcaggcataattcacagggatctaaagcctggaaatttagcagtaaatgaa
gactgtgaattgaagattctggattttggactggcaaggcatacagacagtgaaatgaca
ggctatgtggttactagatggtatagagccccggaggtcatacttaattggatgcattat
actcaaacagttgacatctggtcagtgggctgcattatggcagaaatgataacagggagg
ccactgttcaaaggaaatgatcatctggaccagctcacagaaataatgaagataacaggc
acaccaactcaagatttcgttcagaaactacaaagtcaagatgcaaaaaattatatcaaa
agcctcccaaaagtgcagaaaaaagactttgcagctatcttgaagtatgcaaaccctttg
gctgtaaaccttttggagaagatgctggtgttagatgcggataagagaataacagcagta
gaagctttagcacatccttattttgaaccagttcacgatcctgaagaggaaactgaggca
gagaaatatgatgacacatttgacaatatggatttgccactggatgagtggaagcgcatt
acctataaagaggtactaaacttcaaaccacctcccctgcctgagtcaaaggaaacggca
gtgtaa

DBGET integrated database retrieval system