KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102448836Help
Entry
102448836         CDS       T02980                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102448836 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pss03036]
    102448836 (SETDB1)
Enzymes [BR:pss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102448836 (SETDB1)
Chromosome and associated proteins [BR:pss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102448836 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102448836 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 102448836
NCBI-ProteinID: XP_006132125
Ensembl: ENSPSIG00000008407
LinkDB All DBs
Position
Unknown
AA seq 743 aa AA seqDB search
MISISNSAVQPFHGMMDRVPNEPSYRAPMEKLFYLPHVCSYTCLSRVRPIRSDQYRSKNP
LLIPLLYDFRRMTARRRINRKMGFHVIYKTPCGLCLRTMQEIERYIFETDCDFLFLEMFC
LDPYVLVDRKFQPYKPFYYIADITKGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVYI
NTSWEFLVGCDCKDGCRDKSKCACHQLTVQATGCTPGGQINPNAGYQHKRLEECLPTGVY
ECNKRCKCNMNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTD
DFADKEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDEDEENTGSEEQE
ESNEDSSDDNFCKDEDFSTSSVGQKENGLSETASKDSGLTRQTSQDEVVVTTACKPPMSE
ETSKNKVASWLSSNSMSDSFQDNDSASSFKASEASEARAGKSREKPSASGLGGKEAFGLE
TDSKAQRKEEPEEPSKHSMAPETGKVYGYNPSPMKLEGIRRPPSKTTVHQSRRLLAPPQQ
ATDDVLTLSSSTDSEGDNGQPAAGQAQGNANDSDDIQTISSGSEEEDVEDKKNSSSGLGP
VKRQVAVKSTRGFALKSTHGIAIKSTNMASADKGENMLVRRNTRQFYDGEESCYIIDAKL
EGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEG
MELLCCSKQVAGEALQSFKKPNN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatttccatctcaaactctgctgtgcagccgttccacggcatgatggaccgggtgccc
aacgagccttcctaccgggccccaatggaaaagctcttctacttgccccatgtctgcagc
tacacctgcctgtcacgggtccgccccatccggagcgaccaataccgcagcaagaacccc
ctcctgatcccgcttctctacgacttccggcgcatgactgcccgccgccgcatcaaccgc
aagatgggcttccacgtcatctacaagacgccgtgcgggctgtgcctgcgcaccatgcag
gagatcgagcgctacatcttcgagacggactgtgacttcctcttcctggagatgttctgc
ctagacccctacgtgctggtggaccgcaagttccagccctacaagcccttctactacatc
gcggacatcaccaaaggcaaggaggacgtgccgctgtcctgcgtcaatgagatcgacacc
acccctcctccgcaggtggcttatagcaaggagcgcatcccggggaaaggcgtctacatc
aacaccagctgggagttccttgtgggctgcgactgcaaagacggctgcagagacaaatct
aaatgtgcctgccatcagctgacagtccaagcaacaggctgcacccccggcgggcagatc
aaccccaacgctggctaccagcacaagaggctggaggaatgcctcccgacaggagtctat
gaatgtaacaagagatgcaaatgcaacatgaacatgtgcaccaatcgcttggtacaacat
ggactccaggtcagactccagctgttcaagactcagaacaaaggctggggaatccgctgc
cttgatgatattgccaagggctcttttgtctgcatttatgcagggaaaatcctcacggat
gactttgccgacaaagaggggctggagatgggggacgagtacttcgccaatctggatcac
atcgagagcgtggagaacttcaaggagggctacgagagcgacgccaagtgctcctccgac
agcagcggcgtggacctgaaggacgaggacgaggagaacacaggcagcgaggagcaggag
gagtccaacgaggacagctccgacgacaacttctgcaaggacgaggatttcagcaccagc
tcggtgggccagaaggagaacggcctgtcggagacggcctccaaggactccggcctcacc
cggcagaccagccaggacgaggtggttgtgaccacggcctgcaagccgcccatgtccgag
gagacctccaaaaacaaagtggcctcctggctgagctccaacagcatgtcggacagcttc
caggacaacgacagcgcctcctcgttcaaggccagcgaggccagcgaggccagggcaggc
aaaagccgagagaagcccagtgcgtctgggctggggggcaaggaggcctttggcttggag
acagactcaaaggcgcagaggaaggaggaacctgaagagccaagcaagcattcgatggca
cccgagacaggcaaggtgtatggctacaatccaagccccatgaaactggaggggatccgg
aggccacccagcaagacgaccgtgcatcagagcagaaggcttttggctcctccacaacaa
gcgactgatgatgtgctgacgctgtcgagtagcacggacagcgagggggacaacgggcag
ccggcagcaggacaagcgcagggcaatgcaaacgacagtgacgacatccagaccatttcc
tctggctctgaggaagaggatgttgaggataaaaagaattcctcttccggcctaggccct
gtcaaaaggcaagtggcagtgaaatccacacgagggtttgccctcaaatcgactcacggg
atcgccatcaaatcgaccaatatggcatccgccgacaagggggagaacatgctggtgcgc
aggaacacccgtcagttctatgacggcgaagagtcctgctacatcatcgacgccaaactc
gaggggaacctgggccgctacctgaaccatagctgcagccccaacctgtttgtgcagaac
gtctttgtggacactcacgatctccggttcccttgggtcgccttcttcgccagcaagcgg
atccgggctgggactgagctcacctgggattataactacgaggtgggcagcgtggagggc
atggagctgctgtgctgctctaaacaggtggccggggaggccttgcagtcatttaaaaaa
cccaacaactga

DBGET integrated database retrieval system