KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449407Help
Entry
102449407         CDS       T02980                                 

Gene name
POLB
Definition
(RefSeq) DNA polymerase beta isoform X1
  KO
K02330  DNA polymerase beta [EC:2.7.7.7 4.2.99.-]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102449407 (POLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pss03400]
    102449407 (POLB)
Enzymes [BR:pss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     102449407 (POLB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     102449407 (POLB)
DNA repair and recombination proteins [BR:pss03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102449407 (POLB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     102449407 (POLB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_palm DNA_pol_lambd_f DNA_pol_B_thumb HHH_8 HHH_5 NTP_transf_2 Cdd1 5_3_exonuc
Motif
Other DBs
NCBI-GeneID: 102449407
NCBI-ProteinID: XP_006113294
Ensembl: ENSPSIG00000004491
LinkDB All DBs
Position
Unknown
AA seq 334 aa AA seqDB search
MELHKVHLRGRCTPNVSVHLILFTEGWNVNGTVIFFPYRKAASVISKYPSKIKSGAEARK
LEGVGAKIAEKIDEFLSTGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKLVDEGIKT
LEDLRKNEHKLNHHQRIGLKYFDDFEKRIPREEMLQMQEIALEEVKKLDSEYIATVCGSF
RRGAESSGDMDILLTHPSFTSESTKQPKLLHQVVEQLEKIHFVTDTLSKGDTKFMGVCQL
PNKEDGTNYPYRRIDIRLIPKDQYYCGVLYFTGSDLFNKNMRTHALEMGFTINEYTIRPL
GVTGVAGEPLPVDSEKDIFDYIQWKYREPKERSE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaattgcacaaagtgcatttacgtggaaggtgtacaccaaatgtttctgttcacttg
atattgttcactgaaggctggaatgtgaatggaactgtcattttttttccatatagaaaa
gcagcttctgtaatatcaaagtatccaagcaagataaaaagtggagctgaagcaaggaag
ctggaaggagtaggagctaaaatagctgagaagatagatgagtttttatccactggaaaa
ctacgtaagcttgaaaagattcggcaggatgatacaagctcatctatcaatttcctgacc
cgagttagtggtataggcccttctgcagctaggaagcttgtggatgaagggataaagaca
ttggaagatctaaggaaaaatgaacacaagctgaatcatcatcaacgaattgggctaaaa
tattttgatgactttgagaaaagaatccctagagaagagatgttacagatgcaggaaata
gcattggaagaggtaaagaaactggactccgaatatattgctacagtctgtggcagtttc
aggcgaggtgcagaatcaagtggggatatggatattctcctgacccatccaagtttcact
tctgaatcgaccaaacagccaaagcttttgcaccaagttgtagaacaattggaaaaaatc
cactttgtcacagacacattgtcaaagggtgatacgaaattcatgggtgtatgtcaatta
ccaaacaaagaagatggaaccaattatccataccggagaattgatatcaggctgatcccc
aaggaccagtattattgtggggtactgtacttcacaggcagtgacctattcaataagaac
atgagaactcacgccctggaaatgggcttcacaatcaatgagtacacaattcggcccttg
ggagttactggagttgctggggaacccctcccagtagacagtgaaaaggacatttttgat
tacatacagtggaagtatcgagagccaaaagaacggagtgaataa

DBGET integrated database retrieval system