KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449462Help
Entry
102449462         CDS       T02980                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss04020  Calcium signaling pathway
pss04070  Phosphatidylinositol signaling system
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04310  Wnt signaling pathway
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04621  NOD-like receptor signaling pathway
pss04912  GnRH signaling pathway
pss04916  Melanogenesis
pss04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102449462 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102449462 (PLCB3)
   04371 Apelin signaling pathway
    102449462 (PLCB3)
   04020 Calcium signaling pathway
    102449462 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102449462 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102449462 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102449462 (PLCB3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102449462 (PLCB3)
   04916 Melanogenesis
    102449462 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102449462 (PLCB3)
   04270 Vascular smooth muscle contraction
    102449462 (PLCB3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102449462 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154 C2 DUF913
Motif
Other DBs
NCBI-GeneID: 102449462
NCBI-ProteinID: XP_014432290
Ensembl: ENSPSIG00000012099
LinkDB All DBs
Position
Unknown
AA seq 1220 aa AA seqDB search
MIGDLTEPGALSVPRVREPRAGLVVWVWIRNRADCADTPSFLCTQEPTAQTLVTLRVDPL
GFFLYWNAPHMEVDILDISSIRDTRTGRYARVPKDPKLREILGLGASEARLEENLLTVVH
GPDLVNISFLNFMAVQEDVAKVWTEELFKLAMNILAQNASRNTFLQKTYTRLKLQVNQES
RIPVKNILKMFSADKKRVETALESCGLNFNRSESIKPDEFTLEIFERFLNKLCLRPDIDK
ILLEIGAKGKPYLSLDQLMDFINQRQRDPRLNEVLYPPLSRAQVRQLIDKYETNRQFLER
DQMSMEGFGRYLGGEENSIVPPEKLDLSDDMSQPLSSYFINSSHNTYLTAGQLTGNSSVE
MYRQVLLSGCRCIELDCWKGRPQDEEPFITHGFTMTTEIPFKEVIEAIAESSFKTSPFPV
ILSFENHVDSAKQQAKMAEYCRSIFGEALLIEPLEKYPLQPGMALPSPQELMGRILVKNK
KRRERRASKGPEGSSIRKRLLEATVSDAGPGLGDLPSLPEGSSYVEQHKGATLPVIANGE
EKAPPERLAKLAEPRKSIDREAESEDEEEEEQPDPKKPTTDEGTASSEVNATEEMSTLVN
YIEPVKFKSFHAASKRNKSFEMSSFVETKGLEQLTKSPMEFVEYNKKQLSRIYPKGTRVD
SSNYMPQLFWNAGCQMVALNFQSLDLPMQLNLGMFEYNRRSGYLLKPEFMRREDKPFDPF
TENIVDGIVANTVKVKIISGQFLSDKRVGIYVEVDMFGLPVDTKRKFRTRPSQGNSFNPV
WDEEPFVFPKVVLPTLASLRIAVFEEGGKFVGHRILPVSAIRSGYHYICLRSESNQPLSL
PALLVYTEANDYIPDDHQDYAEALINPIKHVSLMDQRAKQLVALMGESEESAEKPRETPG
KQRADVVAEPPTDPRQPPTALLPPAGNPSVASPGQRDDLIASVLTEVAPQTLEELRKQKG
FIKLLKKQYRELKELRKKHMKNISSLNKKQSTRANQLHSDSLRRRSQVERSLRRGHQDAN
GSLEALEQEVSRQKLALQEGQMRGLLQLRETQHQMERACKIEHLRQAQQRLREIALECQA
AQLKRVKETSEREKKELQKILDRKRHNSITEAKSREKQKKDAELTEINRRHINESVNSIR
RLDEAQKRRQEKLVAGHQQILQQIEEEVPRLVEKLEQECELEAQLLPQEIRRFLQAELEV
GVSNGHPPAAPQEEDESTML
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgataggggacttgacagagccgggggcactgagtgtcccgagggttagggagcccagg
gctgggctagtggtgtgggtctggatcaggaatagagccgattgtgctgacactccctcc
tttttgtgcacccaggagccaacagcccagaccctggtgacgctgcgggtcgaccccttg
ggattcttcctctactggaatgcgccccatatggaagttgacatcttggacatcagctcc
attcgagacacgcggacggggcgctatgccagagtcccaaaggaccccaagttgcgggag
attctggggttgggggcctcagaagcacgccttgaggagaacctgctgactgtggtgcat
ggtccagacctcgtcaacatcagtttcctgaactttatggcggtgcaagaggatgtggcc
aaggtttggactgaggagctgttcaaactagctatgaacattctggcccaaaatgcatct
cgtaacaccttcctgcagaaaacttacacccgactcaaactccaggtgaaccaggagagc
cggatcccagtgaagaacatcctgaagatgttctcggctgataagaagcgcgtggagacg
gctctagagtcctgtggtcttaacttcaatcggagtgagtcgatcaaaccggacgagttc
accctggagatctttgagcgcttcctgaacaagctgtgcctgcgcccagacattgataaa
atcctgctggagattggggcgaaggggaagccctacctgagcctggaccagctgatggat
ttcatcaaccagcggcagcgggacccgcggctgaacgaagtgctgtacccccccctcagc
cgcgcacaggtgcgccagctcatcgataaatacgagaccaaccgccagttcctggagcgt
gaccagatgtcgatggaggggttcgggcgctacctggggggggaggagaacagcatcgtc
ccccctgaaaagctggacctgagcgacgacatgagccagccactgagcagctacttcatc
aactcctcccacaacacctacctcactgcgggccagctgacggggaactcctctgtggag
atgtatcgacaggtgctgctgagtggctgccgctgcatcgagcttgactgctggaagggg
cggcctcaggatgaggagcccttcatcacgcatggcttcaccatgaccactgagatcccc
ttcaaggaggtgatcgaggccattgctgaaagctctttcaagacctccccgttccctgtc
atcctgtcctttgagaaccatgttgactcggccaagcagcaggctaagatggctgagtac
tgtcgcagcatcttcggggaggctctgctgatcgaacccctggagaaatacccgctgcaa
ccaggcatggctctgcccagcccccaggagttgatgggccgcatcctggtgaagaacaag
aagcggcgggagcggcgggcaagcaagggccctgaggggagcagcatccgcaagcgccta
ctggaggccacagtgagcgatgctgggccaggccttggggatctgccttcgctcccagaa
ggctcctcctatgtggagcagcacaagggggccaccctcccagttattgccaatggggag
gagaaggcgccgccggaaagactggccaagctggcagagccccgcaaatctatcgaccgg
gaggctgagagcgaagatgaggaggaggaagagcagccagaccctaagaagcccacaaca
gatgagggcacggccagcagtgaggtgaatgctaccgaagagatgtccacgctggtgaac
tacattgaacctgtcaaattcaaatccttccacgcggctagcaagcggaacaagtccttt
gagatgtcgtccttcgtggaaaccaaggggctggagcagctgaccaagagccccatggag
tttgtcgaatacaacaagaagcaactaagccgcatctaccccaagggcacacgggtcgac
tcctccaattacatgccccagctcttctggaacgccggctgccagatggtagcactcaac
ttccagtctctcgacctgccaatgcagctgaacctgggcatgtttgagtacaatcggcgc
agcgggtacctgctgaagcccgagttcatgcggcgcgaggacaagcccttcgatcccttc
acggagaacatcgtggatggtattgtggccaacacagtcaaggtcaagataatctcgggg
cagtttctgtcagacaagcgggtgggaatctacgtggaagtggacatgtttggcctccct
gtggacaccaagcgcaagttccggacacgcccgtcccaggggaactccttcaaccccgtc
tgggacgaggagcccttcgtcttccccaaggtggtgctgcccacactggcgtccctgcgc
attgctgtctttgaggaggggggtaaattcgtcgggcaccggatcctgcccgtctctgcc
atccggtccgggtaccattacatctgcctgcgtagtgagagcaaccagcctctgagcctg
cctgccctgctggtctacacagaagccaatgactatatcccggatgaccaccaggactac
gcagaggccctgatcaaccccatcaaacatgtcagcctcatggaccagcgggcaaaacag
ctggtggcgctgatgggagaaagcgaggagagtgcagagaagccgcgggaaacacccgga
aagcagcgagctgatgtagtggctgagccccccacggaccctcgacagccacccactgcc
ctgctgccccctgccggcaaccccagtgtcgccagcccagggcaaagggacgacctcatt
gccagcgtcctcacagaggtggccccccaaaccctggaggagctgcggaagcaaaagggc
ttcatcaagctgctgaagaagcagtaccgggagctcaaggagctacgcaagaagcacatg
aagaacatctccagcctcaacaagaagcagagcacccgggccaaccagttgcacagtgac
agcctccggcgccgctcccaggtggagcggagcctgcgccgtgggcaccaggatgccaac
ggctcgctggaggcgctggagcaggaggtgtcccgacagaagctggcactgcaggagggg
cagatgcgtggacttctgcagctgcgagaaacccagcaccagatggagagagcctgcaaa
atagagcacctgcgacaggcccagcagcggctacgggaaattgccctggagtgccaggct
gcccagctcaagcgagtcaaggagacaagtgaaagggaaaagaaggagctgcagaaaatc
ttggaccgcaagcgacacaacagcatcacggaggccaaatcccgggagaagcagaagaaa
gatgcagagctgacagagattaacaggagacacatcaatgagtcagtgaactccatccgc
aggctggatgaggcccagaagcggcgccaggagaagcttgtggccgggcaccagcagatc
ctacagcaaattgaggaagaggtgcccaggctggtggagaagctggagcaagaatgtgag
ctggaagcacagttgctgccccaggagatccgccgcttcctccaagccgagctggaggtg
ggggtgagcaatgggcaccctcctgctgcccctcaggaagaggatgagagcaccatgctg
tga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102455767Help
Entry
102455767         CDS       T02980                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 isoform X1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss04020  Calcium signaling pathway
pss04070  Phosphatidylinositol signaling system
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04310  Wnt signaling pathway
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04621  NOD-like receptor signaling pathway
pss04912  GnRH signaling pathway
pss04916  Melanogenesis
pss04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102455767 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102455767 (PLCB4)
   04371 Apelin signaling pathway
    102455767 (PLCB4)
   04020 Calcium signaling pathway
    102455767 (PLCB4)
   04070 Phosphatidylinositol signaling system
    102455767 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102455767 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102455767 (PLCB4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102455767 (PLCB4)
   04916 Melanogenesis
    102455767 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102455767 (PLCB4)
   04270 Vascular smooth muscle contraction
    102455767 (PLCB4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102455767 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 102455767
NCBI-ProteinID: XP_006136076
LinkDB All DBs
Position
Unknown
AA seq 1206 aa AA seqDB search
MAKPYEFNWQKSVPAFMQDGAVFDRYEEESFVFEPNCLFQVDEFGFFLRWKSEGKEGQVL
ECSLINSIRLGAVPKDPKILAALETGGNSENELEGRIVCVCSGTDLVNISFTYMVAENAD
LAKQWGEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPLAFTYEKFYELTQKICPRTDIEELFRKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDSKRAMQIIETYEPDEDLKNKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHSLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDYFGDLLLKQPLETHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGETAPPVNILEDDNEEEIESADQEEEAHPEFKFGTELSADELSQKEAIANSVKKALE
DSEQENSKKGIVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNFQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGF
GDIVDALSDPKKFLSVMEKRADQMRAMGIETSDIADVPNDTSKNDKKGKANNAKASVTPQ
SSSELRPSTTSGLGPGMETRKGIELIPQVKIEDLKQMKAYIKYLKKQQKELTALKKKHAK
EHSAMQKLHCTQVDKIVAQYDKEKLSYEKMLEKAIKKKGGSNCHEMKKETDIKIQALTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKFS
HDRESKEMRANQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLRKVQLEHLEVLEKQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGL
KLQYAN
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccgtatgaatttaactggcagaagtcagtccctgcctttatgcaagatgga
gctgtgtttgacagatatgaagaggagtcctttgtctttgaaccaaactgtctctttcaa
gtggatgaatttggtttcttcctgaggtggaaaagtgaaggaaaggaagggcaggtatta
gaatgctccctgatcaacagtattcgtcttggagctgtaccaaaggatcccaaaatacta
gctgctcttgagactgggggaaattcagaaaatgagctggaaggacggatagtgtgtgtc
tgcagtggcacggatctggtgaacatcagcttcacgtacatggtagcagaaaatgcagac
ctagctaagcaatggggagaaggacttggatccatcatacataactttagagctaacaac
gtcagtccaatgacatgccttaagaaacactggatgaagctggcatttctgacaaacaca
aatggcaaaattccagttagaagtattaccagaacctttgcatcaggtaaaacagaaaag
gtgatttttcaggcccttaaggagctaggccttcccagtggaaagaatgatgaaattgaa
cctttagcttttacttatgagaaattttatgaactaacacaaaagatatgtcctcgtacg
gacatagaggaactctttagaaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgtctgaatgaaattttattc
ccattctatgattcaaaaagagcaatgcagataattgagacatatgagccagatgaagat
ttgaagaacaaaggtctcatctcaagtgatggcttctgcagatatttgatgtcagatgaa
aatgccccagtcttcctagaccgtttggaattatatcaggaaatggaccattctttggct
cactacttcatcagttcctcccacaatacctatctaacaggcaggcagtttggcgggaag
tcttctgtagagatgtacagacaagtgcttttggctggttgcagatgtgttgaactggat
tgttgggatggaaaaggtgaagaccaagagccaataataacgcatgggaaagcaatgtgt
acagatattctgttcaaggatgtcattcaagccattaaggaaactgcttttgttacatct
gagtatcctgtgatcctctcatttgaaaatcactgcagcaaataccaacagtacaagatg
tcaaaatactgcgaagattattttggagatctccttttgaagcaacctctagaaacacat
ccacttgaaccaggtagacccttaccatcccctaatgacctcaaaagaaagatactcata
aagaacaaaaggctgaaacctgaagtagaaaaaaaacagcttgaggctctgaaaagtatg
atggaggctggggaaacagctccccctgtaaatatcctagaagatgacaatgaggaagaa
atagaaagcgctgaccaagaagaagaagcccatccagaattcaaatttggaactgagctt
tctgcagatgaattgagtcaaaaagaagctattgccaatagtgtcaaaaaggctctggaa
gattctgaacaggaaaacagtaaaaagggtatagtaactgttgaagatgaacaagcatgg
atggcatcttacaaatatgttggtgctacaaccaatatacatccatatttatcaactatg
atcaactatgctcagcctgtaaagtttcaaggtttccatgtagcagaagaacgcaatatt
cattacaatatgtcctctttcaatgaatcagttggactagggtatttgaagacacatgca
attgaatttgtgaattataataaacgacaaatgagtcggatataccccaagggaggcaga
gttgattccagtaattacatgcctcaaattttctggaacgctggctgccagatggtctca
ctgaactttcagaccccagatttagcaatgcagttgaatcagggaaaatttgaatataat
ggatcatgcgggtatctccttaaaccagatttcatgcgacgaccagatcgaacgtttgac
ccattctctgaaacgccagtagatggtgttattgcagcaacttgttcagtacaggtgata
tctggtcagttcttatcagataaaaaaattggtacgtatgtagaagtggatatgtatggg
ttacctacggacacgatacgtaaagaatttcgaacccgcatggtgatgaacaatggtctg
aaccctgtttacaatgaagaatcatttgtatttcgaaaggttattctacctgatctcgct
gtcctgagaatagcagtttatgatgacaacaacagactgattggccagaggatcctgcct
cttgatggccttcaggcaggctacagacacatttcccttcgaaatgaaggcaacaaacca
ctgtctctgcctacagttttctgcaacattgtcctcaaaacatacgttcctgatgggttt
ggagatattgtggatgctttgtcagatccaaagaaatttttatctgtcatggaaaaaaga
gcagaccagatgagagctatgggtattgaaactagtgatatagctgatgtaccaaatgac
acctcaaagaatgataagaaaggaaaagctaataatgcaaaagcaagtgtgactcctcag
agcagctctgaacttagaccatctaccacttctggccttggacctgggatggaaactagg
aaaggtatagaacttattcctcaagtgaagatagaagatttaaaacaaatgaaggcttac
ataaagtatttaaagaaacaacagaaagagctgactgctttaaagaagaagcatgccaag
gagcacagtgctatgcagaagttgcactgcacacaagttgacaaaatagtggcacagtat
gataaagaaaagttatcttatgagaaaatgttagagaaggcgatcaagaagaagggggga
agtaattgtcatgaaatgaagaaagaaactgatattaaaattcaggcattaacatccgat
cacaaatctaaggtaaaagaaattgtcgcccagcatactaaagagtggtcagagatgatc
aacacccacagtgccgaagagcaagaaatccgtgatttgcatctcagccagcagtgtgag
ctactgaaaaaactgctgattaatgctcatgagcaacaaacccaacagctaaagttttct
catgacagggaaagcaaggaaatgcgtgctaaccaggctaaaatttctatggaaaacagc
aaagccataagccaggataaatctattaaaaataaggctgaaagggagaggcgagtaaga
gaactaaacagcagcaacactaaaaaatttctggaagagagaaaaaggctggcaatgaag
cagtcaaaggaaatggatcagttgagaaaagttcagcttgagcatctagaagtcttggag
aaacagaatgagcagcttttgaaatcctgtcatgctgtgtctcaaacccaaggcaaagga
gatgcagcagatggtgaagctggaagcagagatggatcgcaggccagcaacagtggtcta
aagctccagtatgcaaactga

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102460883Help
Entry
102460883         CDS       T02980                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss04020  Calcium signaling pathway
pss04070  Phosphatidylinositol signaling system
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04310  Wnt signaling pathway
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04621  NOD-like receptor signaling pathway
pss04912  GnRH signaling pathway
pss04916  Melanogenesis
pss04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102460883 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102460883 (PLCB1)
   04371 Apelin signaling pathway
    102460883 (PLCB1)
   04020 Calcium signaling pathway
    102460883 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102460883 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102460883 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102460883 (PLCB1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102460883 (PLCB1)
   04916 Melanogenesis
    102460883 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102460883 (PLCB1)
   04270 Vascular smooth muscle contraction
    102460883 (PLCB1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102460883 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 102460883
NCBI-ProteinID: XP_006136102
Ensembl: ENSPSIG00000008760
LinkDB All DBs
Position
Unknown
AA seq 1220 aa AA seqDB search
MLQKMRLEDEELSDESFYLGDVMEKESTILRSSLDDSTVVTPIILRTDPHGFFFYWTDQN
KETELLDLSFVRDARCGKHARAPKDPKLREQLDAGNIGGRLENRMITVVYGPDLVNISYL
NLVAFQEEIAKEWTDEVFSLATNLLAHNMSRDAFLEKAYTKLKLQVTHEGRIPLKSIYRL
FSADRKRVETALEACNLPSARNDSIPQEDFTPEAYRVFLNNLCPRPEIDNIFSEFGAKSR
PYLAVDQMMEFINYKQRDPRLNEILYPPMKQEQVQQLIEKYEPNNSLAKKGQISVDGFMR
YLSGEENGVVPPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGSSSVEMYRQVLLSGC
RCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDS
PKQQAKMAEYCRLIFGDALLMDPLEKYPLESGVPLPSPMDLMHKILVKNKKKSQKSADGS
SKKKVAEQASNTCSDASSGFEPSSPGAGEAEIESDDDDDDDDDCKKSSMDEGTAGREAMA
TEEMSNLVNYVQPVKFESFEISNKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKRQLSR
IYPKGTRVDSSNYMPQVFWNAGCQLVALNFQTVDLSMQINMGMYEYNGKSGYRLKPEFMR
RPDKHFDPFTESIVDGIVANTLSVKIISGQFLSEKKIGTYVEVDMFGLPVDTRRKALKTK
TSQGNAINPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVSAIRPGYHYICL
RNERNQPLMLPAVFVYIDVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEE
EVKKEAEQGDPPSEANHEPRPTPAENGLSHSTSLTTKPATQVVHSQPAPGSVKAPAKTED
LIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTAKYNEIQ
NDYLRRRAVLEKSTKRDSKKRCETGSPDHSSTIEQELAALDSEMTQKLIELKEKQQQQLL
NLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQSSQLKKLKETCEKEKKELKKKMDKKRQ
EKITEAKTKDKNQMDEEKTEMIRSYIQEVVQYIKRLEDAQSKRQEKLVEKHKEIRQQILD
EKPKLQVELDQEYQDKFKRLPLEILEFVQDAMKGKISDDGDHSSTPSSMPSDSGKMNHKP
LQNEEETEENNPEKMFDTPF
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagaagatgagacttgaagatgaagagctctcggatgagagtttttaccttgga
gatgttatggagaaggaatccacaatacttagatctagtctggatgattccactgttgtg
actccaattattctcagaacagatccacatggatttttcttttactggacagatcagaat
aaggagacagagctgctggatctcagcttcgtcagagatgccagatgcgggaaacacgcc
agagctcccaaggatccaaaattgcgtgaacagttggatgctgggaacataggaggtcgt
ctggagaatcgaatgataactgttgtctatggcccagacttggtcaatatatcgtacttg
aacttagtggcatttcaagaggaaatagcaaaggaatggacggacgaagttttcagtttg
gcaacaaatctgctggcacacaacatgtcaagggatgcatttctggaaaaagcttacaca
aaacttaagctgcaagtcactcacgaaggacgtattcctctcaagagcatataccgcttg
ttttccgctgacagaaaacgagtagagactgcattagaagcttgtaaccttccatctgcc
aggaatgattcaatccctcaagaggacttcaccccagaagcctacagagtattcttaaac
aatctgtgccctcggcctgaaattgacaacatcttttctgagttcggtgccaagagcaga
ccataccttgctgttgatcagatgatggagtttataaattataagcaacgtgatccacgg
ttaaatgaaatcctttatccaccaatgaagcaggagcaagttcaacaactgattgagaaa
tatgaacccaataatagtctagcaaagaaaggacagatatcagtggacggatttatgcga
tacctgagtggagaggagaatggcgtcgttccacctgagaaactggatttgaatgaagat
atgtctcagccgttgtctcactatttcatcaattcctcacacaacacctacctcacagct
ggacagctggctgggagctcctcagtagagatgtatcgccaagtgctcttgtcaggctgc
cgctgtgtggagctggactgttggaaggggcgaacggcagaagaagagccagtcattaca
catggattcaccatgaccactgaaatatccttcaaggaagtaatagaagctattgctgag
tgtgcatttaagacatcgccttttccaatcctcctttcctttgaaaaccacgtggattcc
cctaagcagcaagccaaaatggcagaatattgcagattaatttttggcgatgcactgctc
atggatccactggaaaaatacccacttgaaagtggcgttccccttccaagccctatggac
ctaatgcacaaaattctggtgaagaataaaaagaaatcacaaaagtctgccgatggaagt
tccaaaaagaaggtagctgagcaggcttccaacacgtgcagtgatgcatccagtgggttt
gaaccgtcttctcctggagcaggagaagcagagattgaaagtgacgatgacgatgacgat
gatgatgactgtaaaaaatcatccatggatgaaggcaccgctggccgtgaagccatggcc
acggaagaaatgtccaacttggtgaactacgtacagccagtgaagtttgagtcatttgag
atatcaaacaaacgaaacaagagttttgaaatgtcttcctttgtggaaaccaaaggtctt
gagcaactcacaaagtctccagtggaatttgtggaatataacaaaaggcagcttagccgg
atttatccaaagggaacacgtgtagattcctcaaactacatgccacaagtcttctggaat
gctggctgtcaattggttgctcttaacttccaaactgtagatttgtctatgcaaataaac
atggggatgtatgaatacaatggcaaaagtgggtacaggctaaagccagagttcatgaga
agaccagacaaacattttgacccatttaccgaaagtattgtggatggaatagtagccaac
actctgtctgtgaagataatttcaggtcagtttctttcggagaaaaaaatcggtacttat
gtagaagtagacatgtttggcttgcctgtggatacaagaagaaaagctttaaagacaaag
acctctcaaggcaatgctattaaccctgtatgggaagaggaacccattgtatttaagaag
gtagttctgccttctctggcatgtttaaggatagcagtatatgaggaaggaggaaagttt
ataggacatcggatattgcctgtctcagcaattcgaccaggctatcactacatctgtctg
cgaaatgagcggaaccaacctttgatgcttccagcagtctttgtgtacatagatgttaag
gactacgtacccgatacttatgcagatgtgattgaagcattatccaacccaatccgatat
gtaaacttgatggaacaaagagctaaacagctggcagcactcacactggaggatgaagaa
gaggtaaagaaagaggctgaacagggagatccaccatcagaagctaatcatgagcccaga
ccaacaccggcagaaaatggactaagtcactccacttctctgacaacaaagccagcaact
caggttgttcacagccaaccagccccgggttctgtgaaagctcctgccaaaacagaggat
cttattcagagtgtcctaacagaagtggaagcccaaaccattgaggaactaaaacagcag
aagtccttcgttaagctgcagaagaagcactacaaagaaatgaaggaccttgtcaagaga
catcacaagaaaaccaccgatctgattaaagagcacactgcaaagtacaatgaaatccag
aatgactacctgcgacgtagagcagtcttagaaaagagcaccaaacgggatagtaagaaa
agatgtgaaactggaagcccggatcacagttcaactattgaacaagaactggctgccctt
gattcagaaatgacccagaagttaatagaactgaaggaaaagcaacaacagcagcttctc
aatctccgacaagaacagtattatagtgaaaaatatcagaagcgagaacatattaagctg
ctcattcagaagttgacagatgtggcagaagaatgtcagagcagccagttaaagaagcta
aaagagacgtgtgaaaaagaaaagaaggagttaaagaagaaaatggacaagaagaggcag
gagaagattacagaagctaaaaccaaggataaaaatcaaatggacgaagagaagacggaa
atgattcgatcgtatatccaggaagtggtgcagtacataaagaggctagaagatgctcag
agtaaaagacaggagaaacttgtggaaaaacataaggagattcgtcagcaaatactggat
gaaaagcccaagttacaagttgaactggatcaggaatatcaagacaaattcaaaaggctc
cctctggaaattctggagtttgtacaggatgcgatgaaagggaaaatcagtgacgatgga
gaccacagttctaccccttcctccatgccatctgacagtggaaaaatgaatcataaacct
ctgcaaaacgaagaggaaacagaagaaaataatccagagaaaatgtttgatactcctttt
taa

KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102461092Help
Entry
102461092         CDS       T02980                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00562  Inositol phosphate metabolism
pss04020  Calcium signaling pathway
pss04070  Phosphatidylinositol signaling system
pss04261  Adrenergic signaling in cardiomyocytes
pss04270  Vascular smooth muscle contraction
pss04310  Wnt signaling pathway
pss04371  Apelin signaling pathway
pss04540  Gap junction
pss04621  NOD-like receptor signaling pathway
pss04912  GnRH signaling pathway
pss04916  Melanogenesis
pss04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102461092 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102461092 (PLCB2)
   04371 Apelin signaling pathway
    102461092 (PLCB2)
   04020 Calcium signaling pathway
    102461092 (PLCB2)
   04070 Phosphatidylinositol signaling system
    102461092 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102461092 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102461092 (PLCB2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102461092 (PLCB2)
   04916 Melanogenesis
    102461092 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102461092 (PLCB2)
   04270 Vascular smooth muscle contraction
    102461092 (PLCB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102461092 (PLCB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like DUF1154 C2 AAT DUF3726 EF-hand_14
Motif
Other DBs
NCBI-GeneID: 102461092
NCBI-ProteinID: XP_006128715
Ensembl: ENSPSIG00000010716
LinkDB All DBs
Position
Unknown
AA seq 1212 aa AA seqDB search
MSMLTPILMPPEVKEYLSKGERFIKWDDDTTNASPVILRVEPKGFYLYWTYQNKEMDFLD
ITSIRDTRVGKFAKIPKSQKLREVFNLDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKSWAEDIMAIVRNPLTYNASRYTFLEKILVKLKMQLNAEGKIPVRNIFQMFPADRKR
VEAALHACHLPKSKNDAINPEDFPEKVYKTFLMNLCPRPEIDEIFTSLHSKAKPYMTKEH
LAKFINKKQRDSRLNDILFPPAKPEQVQGLIEKYEPSGINIQRGQLSPEGMVWFLCGPEN
NVVSLDKVVLYQDMTQPLSHYFINSSHNTYLTAGQFSGISSPEMYRQTLLAGCRCVELDC
WKGRPPDEEPIITHGFTMTTEILFKDAIEAIAESAFKTSLYPVILSFENHVDSPKQQAKM
AEYCRTIFGDMLLTEPLEKYPLKPGVPLPSPQDLLGKILIKNKKNQSVSEDRRDSLKKDR
NEATDQPVPMDGDDTVWAGDVTEEDPEEEEEESGNLDEEQIKKMQSDEGTAGLEVTAYEE
MSSLVNYIQPIKFDSFDISTEQNRSYVISSFTEMKAYDLLTKSPVQFVEYNKRQMSRIYP
KGTRMDSSNYMPQMFWNVGCQMVALNFQTMDVPMQQNMALFEFNGQSGYLLKHEFMRRPD
KQFDPFSVDRIDVVVASTLSITILSGQFLSERSVKTYAEVELFGLPGDPKRKYRTKLTSS
ANSINPVWKEEAFVFEKIMMPELASLRIVALEEGGKFIGHRIIPIIAVHSGYHHVCLRSE
SNMPLTMPSLFVYLEMKDYVPDTWADLTAALSNPIKFFNIQEKRSVKLKENSAERPDMQK
NLTEAQTNGIPHSTRSFSLPLPNGPEGAMGLGKEETIKEIAKEIAELETASLEELQKMKL
FLKLLKKQEKELKELERKGSKRREELLQRYSELVTQGGRKKIICPGKTQKKKRSLTAEEI
SAAWSPAEMAAEYAESQVLELKEKLEMELMQLWEEQYDGMRKKKEQHATEQIARLMEIAR
EKQAAEMKAMKESSESDTKELKKKLEAKRLDRIQAMIKSTSDKTAQERLKREINNSHIQE
AVPKIKQMTEKMEKYQQILEKKQSDCLEKIKEKESQLHKEALAEYEDKVKTLHLEVQDLA
KNCMKVCFPLEANIKKEEALNTSNEGELGYKDQPEGKTPETEASGLETSMAGTSMAQIQK
IEISDQSMESIF
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgctcacacccatcctgatgccccctgaggtaaaggagtatctatccaagggc
gagcgcttcatcaaatgggatgatgacacaacgaatgcttctcctgtaattctccgggtg
gagccaaaaggcttttacttatattggacatatcagaataaggagatggactttttggat
ataaccagcatccgagacacccgagtagggaaatttgccaaaatccccaagagccagaag
ctccgggaagtttttaacttggatttcccagacaacaacttccttctcaagactctcact
gttgtgtctggccccgacatggtggatctcactttccacaactttgtctcttacaaagag
aatgttggcaagagctgggctgaggatatcatggccattgttagaaacccactgacatac
aatgcgtctcgctacaccttcctggagaaaatcctggtgaagctgaaaatgcagctgaat
gctgaaggaaaaattcctgtcaggaatatttttcagatgtttcctgcagacagaaagagg
gtagaagctgcattacatgcttgtcaccttccaaagagcaagaatgatgcaatcaatcca
gaggacttccctgagaaggtgtataaaacctttctgatgaacctgtgtccccgtccggag
atcgatgagatattcacctctctccattcgaaagccaagccctacatgaccaaagagcac
ttggcaaagtttattaacaagaaacagcgagattcccgcctcaatgacatcctcttccct
cctgccaagccagagcaggtgcaaggcctgatagagaagtacgaacccagtgggattaac
atccagagagggcagttgtctcccgaggggatggtctggttcctttgtggtcctgaaaac
aatgttgtatcactggacaaagtagtgctgtaccaggacatgacccagccactctcacat
tacttcatcaactcatcacacaacacctacttgacagctggccagttttctggcatctct
tctcctgaaatgtatcgtcagaccctgctggctggctgccgttgtgtagagctggactgc
tggaagggtcgtcccccagatgaagagcccatcatcacccatggattcaccatgacaact
gagattctcttcaaggatgccattgaggccatagcagaaagtgctttcaaaacctctctc
tacccagtgatcctgtcctttgaaaaccatgttgactcgcccaagcagcaagctaagatg
gctgagtactgcagaaccatatttggggacatgctgctgacagagccactagaaaaatat
ccactgaagccaggtgtccctttgccaagccctcaggatctcttagggaaaatcctgatt
aagaacaaaaagaaccaatctgtgtctgaggacaggcgggactctttgaagaaagacagg
aatgaagctactgaccagcctgtccctatggatggtgatgataccgtctgggcaggtgat
gtgactgaagaggacccagaggaagaggaggaggaatctggaaacttggatgaagaacag
attaaaaagatgcagtcagatgagggcactgctggcttagaagtgacagcttacgaggaa
atgtccagcctggtcaattacatccagcccatcaaatttgactcctttgatatctcaaca
gagcagaaccgaagttatgtcatctcctccttcactgaaatgaaggcttatgatctactg
accaaatctcctgtgcaatttgtagaatataacaagcgacagatgagcaggatttacccc
aagggcacccggatggactcctccaactacatgcctcagatgttctggaatgtcggctgt
cagatggtggccttaaacttccagacaatggatgtccccatgcaacagaacatggccctc
tttgagttcaatggccaaagcggctaccttctcaaacatgaattcatgaggcgtccagac
aagcagttcgaccctttttctgtggaccgcattgatgtggtggtagcaagcaccctgtcg
ataacgatcctttctggccagttcctctcagagcgcagtgtgaagacatatgcagaagtg
gaactttttggtttgccaggagacccaaaacgtaaatacagaaccaagctgacatcaagt
gccaattccatcaatcctgtatggaaggaggaagcatttgtttttgaaaagattatgatg
ccagagttggcttctctcagaattgtggctttggaggaaggaggaaagttcattggtcat
cgcatcattcccattattgctgtgcattcaggctatcaccatgtttgccttcgcagtgaa
agtaacatgccactcactatgccctccctatttgtgtacctggagatgaaggactatgtc
cctgacacctgggcagatctgactgctgctctatccaaccccattaagttctttaatatc
caggagaagagatcagtgaaactaaaagagaactctgcagagaggcctgacatgcagaag
aaccttacggaagctcaaaccaacggaataccacattctaccaggagctttagtttgcct
cttccaaatggacctgaaggagctatgggcctggggaaggaagaaactataaaagaaatt
gcaaaagaaattgcagaactcgagacagccagccttgaggaacttcagaagatgaagctt
tttctgaagctgctgaagaaacaggagaaggagctgaaggagctggagcgaaagggaagc
aagcgcagggaagagctgctgcagagatattcagagttggtcactcagggtggcaggaag
aagatcatatgccctgggaaaacacagaaaaagaaaaggagtttgaccgcagaggaaatc
agtgcagcatggagtcctgcagagatggcagcagagtatgctgaaagccaagtcttggag
ctgaaagagaagctggaaatggagctaatgcaactgtgggaagagcagtatgatgggatg
cggaaaaagaaggagcagcatgccacggagcaaattgctagactgatggaaatagcaagg
gagaagcaggcagctgagatgaaggcaatgaaggaatcctcagaaagtgatactaaagag
ttaaagaagaaactagaggcaaaaagactggaccgaatccaagccatgatcaagagcacc
agtgacaagactgctcaggagagattaaagagagaaataaataattcccatattcaagaa
gcggtgccaaagatcaaacagatgacagaaaagatggaaaagtatcaacagatactggaa
aagaagcagtcagattgtctagaaaagatcaaggagaaagaaagccagctccacaaagag
gcactggcagagtatgaggataaagtgaaaacccttcacctggaggtacaagatttggca
aagaactgtatgaaagtctgcttccctctggaggctaacatcaagaaggaagaagctctg
aacaccagcaatgaaggcgaactagggtataaggaccaaccagaaggaaagacacctgaa
actgaggcatcaggacttgagacatccatggcagggacctccatggctcagatccaaaaa
attgagatatctgaccagagtatggaaagtatattttga

DBGET integrated database retrieval system