KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449474
Entry
102449474         CDS       T02980                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 102449474
NCBI-ProteinID: XP_006132814
LinkDB
Position
Unknown
AA seq 313 aa
MGPGQGRLHVLARRRAGPHDPRRDQPLDASPSPAPQSLACSRLVSPAEFPYCKFTCHYRC
RALIRLDCSGPRDQDSDPAEATQQTVERDTNVDEQIDWEKPVLSQAEIEQKIKEYNSQIN
SNLFMSLNKDGSYTGFIKLQLKLIRPVSVPASKKPPSIQDMKKAPRSQAVKRRTSFYLPK
DTVKHLHIISRTRASEVIEALLRKFMVVDNPRKFALFERAEKDDQGTGLLSPLAADQPLR
LRLLAGPSEKALSFVLKENETGEVNWDAFSMPELHNFLRILQREEEEHVRQILQKYTRCR
QQLQEALTARTPG
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggcccggggcaaggccggctgcacgtcctggcccgtcgcagggctggcccccacgac
ccccgcagggaccagccccttgatgcctcccccagtccagctccgcagtctctggcctgc
tccaggctggtcagtcctgctgagttcccctactgcaagttcacctgccactaccgctgc
cgcgccctcatccgcctggactgcagcggcccccgggaccaggacagcgacccggccgag
gccacccaacagaccgtggagagagacaccaatgtggatgagcagattgactgggagaag
ccggttctcagccaggccgagatcgagcagaagataaaggaatacaacagccagatcaac
agcaacctcttcatgagcctgaacaaggatggctcctacactggcttcatcaagctgcag
ttgaagctaatccggccagtctcagtgccagccagcaagaagccgccctccatccaggac
atgaagaaggcgccgcggtcccaggcagtgaagcgccgcacgtccttctacctgcccaag
gacacggtcaagcacctgcacatcatctcccgcacccgtgccagcgaggtcatcgaggcc
ctgctcaggaagttcatggtggtggacaacccccgcaagtttgccctcttcgagagagcg
gagaaggacgaccaaggtaccggcctcctctcccccctggctgcagaccagcccctgcgt
ctccggctgctggctggccccagcgagaaggccctcagcttcgttctgaaggagaacgag
accggagaggtcaattgggacgcgttcagcatgcccgagctgcacaacttcctgcgcatc
ctacagcgcgaggaggaggagcacgtccggcagatcctgcagaagtacacccggtgccgc
cagcagctgcaggaggcgctgaccgcccgcaccccaggctga

DBGET integrated database retrieval system