KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102449540Help
Entry
102449540         CDS       T02980                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00052  Galactose metabolism
pss00500  Starch and sucrose metabolism
pss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102449540 (GANC)
   00500 Starch and sucrose metabolism
    102449540 (GANC)
Enzymes [BR:pss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102449540 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N Ntox21
Motif
Other DBs
NCBI-GeneID: 102449540
NCBI-ProteinID: XP_006130414
Ensembl: ENSPSIG00000010291
LinkDB All DBs
Position
Unknown
AA seq 913 aa AA seqDB search
MEPAKEEGISVQDEAVDKSNFKNCNHIAFYRRQKLLHPGKSLYKALLDSVTLCNDSVTLQ
IINEKVSLLVEIYAIEGNVFRLKINEVSPLKSRYEVHDVLIKEPTTQRLSIAQKEAGILV
LTCDHEDHKLHITANPFQIVLESKGETVLSVNGNGLLYFEHLQPPPQNSKSTAQNKEDTP
TDSSQENQEDLSLWEEKFGSFLDIKANGPSSIGLDFSLHGFEHVYGIPEHAETLLLKNTS
DNDAYRLFNLDVYGHKIHDKMGIYGSVPFLLAHKLNRTSGIFWLNSSETLVEINTKAVME
HVPCRSPPDVTKQRVVPQTDVRWMSESGIIDVFLLMGPSPFDLFKQYAQLTGTQALPPFF
SLGYHQCRWNYEDEQDVEAVDAGFDEHDIPYDVIWLDIEHTEGKRYFTWDKKKFHNPKRM
QELLKRKKRKLVVIIDPHIKVDPTYAIYSEAKKKGYFVKDRKGHDFEGICWPGSSSYLDF
TSPEVREWYADQFAFRSYKGSTDILFVWNDMNEPSVFKGAELTMQRDAVHHGNWEHREVH
NLYGFYQQMATAEGLIKRSEGQKRPFVLTRSFFAGSQKYGAVWTGDNVAKWSYLKISIPM
LLTISIAGISFCGADVGGFIGDPDPELLVRWYQAGAYQPFFRGHANIDSKRREPWLFGDE
NTRLIREAIKERYTLLPYLYSLFYRAHTTAEPVMRPLWVEFPKEQETFGVEDEYMLGNAL
LVHPVAEQEITTMNILLPGSDEVWYDFRRFRRQDCPGTLKIPVTLESIPVFQRGGSVVPL
KTKVGRSTEWMTDISYELRVALDSKDFAVGELYLDDGHSFHYLQKKQFLHRKFTFHKKVF
SSSCADEIGQYHTKCVVERILILGVQKQPTSVNANLQDGKDKEVVFTYDITTSMLTLEKL
LLNIGDDWEIHIM
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagctaaggaagaaggaatcagtgtccaagatgaggctgtggacaaaagcaac
tttaagaactgcaaccacattgctttctacagacgtcagaaacttctgcatcctgggaag
tccttgtataaagcattgttggattcagttacattatgcaacgacagtgtcacactccaa
ataattaatgagaaggtttctctcctagtggaaatttatgcaatagaaggcaacgttttc
aggcttaaaattaatgaggtatcgcctctcaaatcaagatatgaagtccatgatgttctc
ataaaagaacctaccactcagaggctctctatagcccagaaggaggcaggcattctggta
ctgacatgtgatcatgaggaccacaagcttcacatcacagcaaatccattccagatagta
ttagagtccaagggtgagactgtactgagtgtgaacggcaatggcctgttgtactttgag
catctacaaccaccaccccaaaacagcaaaagcacagcacagaacaaagaggacacacca
actgactcctctcaggaaaatcaagaggatctgagtctctgggaagagaaatttggcagc
tttttagacatcaaagctaatggtcccagttccataggcttggatttttctttgcatgga
tttgaacatgtctatggaataccagagcatgcagagacacttctcctcaaaaacaccagt
gacaatgatgcctaccgactttttaacttggatgtctacgggcacaagatccatgacaaa
atgggcatttatggttcagtaccttttctgttagcacataaacttaacagaacttctggg
atcttctggctgaattcctcagaaactctagtggaaattaatacaaaagctgtaatggag
catgtaccatgcagatcccctccagacgtgactaagcagagagttgtgcctcaaacagat
gtgcgttggatgtcagaaagtggaataattgatgttttcttgctaatggggccctcccct
tttgatctcttcaagcaatatgcacaattaacaggcactcaagccttgcctccattcttc
tccttgggctaccaccagtgccgctggaactatgaggatgagcaggatgtagaagcagta
gacgctggctttgatgaacatgacatcccgtatgatgttatatggctggacatagagcac
acagagggcaagagatacttcacctgggacaagaaaaaattccacaaccccaaaaggatg
caggaactgctcaagaggaaaaaacgcaagcttgtcgtcattatagatcctcatattaag
gttgatcccacgtatgccatatattctgaggccaaaaaaaaggggtattttgtgaaggac
cgaaaaggccatgactttgagggcatctgttggccaggttcctcttcttacctggatttt
accagtcctgaagtccgagaatggtacgcagatcagtttgccttcaggtcatataagggt
tctactgacatcttgtttgtatggaatgatatgaatgagccttcagtcttcaaaggggca
gaactaaccatgcagagagatgctgttcaccatggcaactgggagcaccgggaggttcac
aatctctatggtttttaccagcaaatggcaactgcagaaggactcatcaaacgctctgag
ggacagaagaggccatttgtcctcacgcgctctttctttgctggatcacagaaatatggt
gccgtatggacaggagacaatgtagcaaagtggagttacttaaaaatctccattccaatg
ttgcttacaatcagcattgcaggaatttcattctgtggagctgatgtgggcgggtttatt
ggggatccagacccagagctacttgttcgctggtatcaggctggtgcataccagcctttc
ttcagaggccacgccaatatcgacagcaaacgacgtgaaccatggctatttggggatgag
aacacacggctcatcagggaggccattaaagagcgatacacccttctgccctacttgtat
tcactgttctaccgggcacacactaccgctgaaccagtcatgaggcctctctgggttgag
ttccccaaggaacaagaaacttttggtgtggaagacgaatacatgctaggaaatgcttta
ctggtgcatccagtcgctgaacaagagatcactaccatgaacattttactgccagggtct
gatgaggtttggtatgacttcagaagatttagacgacaggactgtccaggcactctgaag
ataccagtaacactagagagtattccagtgttccagcgaggagggagtgtggtgcctctt
aagaccaaagtgggaagatccactgaatggatgacagatatttcttacgaactccgtgtt
gctctggactccaaggactttgcagtaggtgagctctatctagatgatgggcattcattt
cactacctccagaagaagcaattcctgcacaggaaattcacattccacaagaaagttttc
tcttccagctgtgctgatgaaattgggcaataccacacaaaatgtgtagttgaacggata
ctaattctaggagttcagaagcagcccacatctgtgaatgccaatctccaggatgggaaa
gacaaagaagtggttttcacgtatgatatcacgacctccatgttgaccctggaaaagcta
ttattgaatattggtgatgactgggaaattcacatcatgtga

DBGET integrated database retrieval system