KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450716Help
Entry
102450716         CDS       T02980                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04012  ErbB signaling pathway
pss04068  FoxO signaling pathway
pss04110  Cell cycle
pss04115  p53 signaling pathway
pss04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102450716 (CDKN1A)
   04068 FoxO signaling pathway
    102450716 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102450716 (CDKN1A)
   04115 p53 signaling pathway
    102450716 (CDKN1A)
   04218 Cellular senescence
    102450716 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI TetR_C_8
Motif
Other DBs
NCBI-GeneID: 102450716
NCBI-ProteinID: XP_006125354
LinkDB All DBs
Position
Unknown
AA seq 156 aa AA seqDB search
MPLSQSTIRQTPCSRKLCRNLFGPVDHEQLQNDFQDLMRRHLEEAQHRWNFDFEMETPLE
GEFKWERVLSPDVSPVCLPSQALLSYAKGSDGENHQSSPALRISTRDLNVALSKEAGQLG
SGSHLASSARCVKRKQTSIKDFYSLKRRMVPGKPNP
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtcacagagcaccatccggcagaccccctgcagcaggaagctctgccgaaac
ctctttggcccagtggatcatgaacagctccagaatgacttccaggacttgatgagaaga
cacctggaagaagcccagcacagatggaattttgactttgagatggaaacgcccctggaa
ggtgaattcaagtgggagagagtcctctctcctgacgtgtctcctgtttgcctgccttcc
caagccctcctgagctatgcgaaaggtagcgatggggagaaccaccagagctctccagca
cttaggatttccacaagagaccttaatgtggccctctcaaaggaagcagggcagctgggg
tctgggtcccacctggccagctccgcacgatgcgtgaaacgaaagcagaccagcataaaa
gatttctacagtttgaagcggaggatggtccctggcaaaccaaatccatga

DBGET integrated database retrieval system