KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102450818Help
Entry
102450818         CDS       T02980                                 

Gene name
CBL
Definition
(RefSeq) LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss04012  ErbB signaling pathway
pss04120  Ubiquitin mediated proteolysis
pss04144  Endocytosis
pss04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102450818 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102450818 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102450818 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102450818 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pss04131]
    102450818 (CBL)
   04121 Ubiquitin system [BR:pss04121]
    102450818 (CBL)
Enzymes [BR:pss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102450818 (CBL)
Membrane trafficking [BR:pss04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102450818 (CBL)
Ubiquitin system [BR:pss04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    102450818 (CBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N2 Cbl_N3 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-RING_4 zf-rbx1 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 102450818
NCBI-ProteinID: XP_014428317
LinkDB All DBs
Position
Unknown
AA seq 868 aa AA seqDB search
MVKSETVVSEDNCVIAWYLVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKM
ETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELK
GIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKTFRQALHEVHPISSGLEAMALKS
TIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTXXXXXXXXXXXXXTRLQKFIHK
PGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNP
DLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTA
WQESEGQGCPFCRCEIKGTEPIVVDPFDPRGGGGLLRQCAEGAPSPNYDDDEDDRADDPL
FMMKELAGAKVERPPSPFSVAPQASLPPVPPRLDLLQQRVSVPSGASSPGTTSKVAAGPL
HKDKPLPVPPTLRDLPPPPPPDRPYSTGAENRPQRRPLPCTPGDCPSRDKLPPVPSSRPG
EPWPSRPIPKAPSAGLSPSDPWANRELTNRHSLPFSLPSQIDSRPDAPRHGSTLSLDTTA
NLNSGAPVGSEYEHPKIKPSSSANAIYSLAIRPLPVPKRQPGEQSESDEDTEYMSPSSLP
LVPPGPAQQKTEIKLPLEMTHGLRALEYDLSNDVCMYEAMYNIQSQATSSDLEATKSSDE
GDVAAANASNGPEESENEEDGYDIPKPPVPVAIARRTLSDISNATSAFSRMSLDGDPSTG
SSDGSQVPERPPKPLPRRINSERKAGSCPQGGPSASPQLSSEIENLMSQGYSYQDIQKAL
VIAHNNIEMAKNILREFVSVSSPAHVAT
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaagtgaaactgtggtctcggaagacaattgtgtcatagcttggtacttggtg
gtacgtttatgtcagaatccaaaactggcactaaagaacagcccaccctatattctagat
ctgctacctgatacgtatcagcacctacgaaccatcctgtcacgctatgaggggaagatg
gagaccctaggagaaaatgagtatttcagggtcttcatggaaaacctgatgaagaagacc
aaacagactatcagcctctttaaggaagggaaggagaggatgtatgaggaaaactcgcag
cctaggcgtaacctgacaaaattgtccctgatatttagccatatgctggcagaactgaaa
ggtattttcccgagcggcctcttccaaggagatacgttccggatcaccaaggcagatgct
gcagagttctggaggaaagcttttggggaaaagacaattgtcccttggaagaccttccgc
caggccttgcatgaggtgcatcctatcagttcgggactagaggccatggccctgaagtcc
actattgacttgacatgcaatgactacatttcagtgtttgaatttgatatatttacccgg
ctctttcagccatggtcctctttgctcaggaactggaatagcctagctgtgactnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnaaacaaggcttcagaaatttattcacaaa
cctggcagttacattttccgattgagctgtacgcgactcggtcagtgggccattggctat
gtcactgcagatgggaacattctccagactatcccccacaacaaacctctttttcaagca
ctgattgatggcttcagggaaggcttttatttatttcctgatggtcggaatcagaatcct
gacctgactggtttgtgtgagcctacacctcaggaccacattaaagttacacaggaacaa
tatgaattgtactgcgagatgggctccacattccaactgtgtaaaatctgtgcagaaaat
gacaaggatgtgaagattgagccatgtggccacctgatgtgcacttcctgtctcactgca
tggcaggaatcagaaggtcagggctgccctttctgccgctgtgaaatcaaaggcacagag
cccattgtagtcgacccatttgatcccagaggagggggaggattattgcggcaatgtgca
gagggagcgccctccccaaactatgatgatgatgaagacgacagagcagatgatcccctc
ttcatgatgaaagaattagctggtgctaaggttgagcgccctccttctccattctcagtg
gctccgcaagcctcccttccgccagtacctccacgactcgatcttctgcagcagcgcgtg
tccgtcccttctggagcatccagccctgggactacttccaaggttgctgctggtcctctc
cataaggataaacctctgccggttccgccaacgctccgagatctcccacctccgccccca
ccagacaggccatattccactggggcagagaatcgacctcagagacgtcctctaccctgt
acaccaggagactgtccttccagagacaaattacccccggtgccctccagccgtccgggg
gaaccctggccatcacggccaattccaaaagcaccgtctgcaggtctcagtcctagtgac
ccttgggcaaatagagagctgacaaaccggcactcactcccattctccctaccatctcag
atagattccagacctgatgctcctaggcatgggagtacgctcagcctagacaccacagcg
aacttgaacagtggtgccccagtgggctcagaatatgaacaccccaaaataaaaccttca
tcatctgccaatgctatctactctctagcaatcagaccactgcctgtgccaaaacggcaa
cccggggaacagtccgaaagtgatgaggatactgaatacatgtcaccatcctctttgcct
ctggtgccgcctggtcctgcccaacaaaaaacagagatcaaactgcctttggaaatgact
catggtcttcgagcattggaatatgacctatcaaatgatgtctgtatgtatgaagctatg
tacaacatccagtcccaggcaacgtcctctgacttggaggccactaaaagttctgatgag
ggggatgtagctgcggccaatgccagcaatggcccagaagagtccgagaatgaagaagat
ggctatgatatccccaaaccaccagtaccagtcgcaatagctcgtcgcacactctccgat
atctccaatgccacgtctgccttcagccgaatgtctctggatggtgatcccagcacaggt
tcttctgatggctctcaagttccagaaaggccaccaaagcccttaccacggaggataaat
tctgaacggaaagccgggagttgtccgcaggggggccccagcgcctctccccaactttcc
agtgagattgagaaccttatgagccagggatactcatatcaggacattcagaaagctctg
gtcattgcacataacaatattgaaatggccaagaatattctccgggaatttgtctccgtt
tcgtcccctgcacatgtggccacatag

DBGET integrated database retrieval system